KEGG   Rattus norvegicus (rat): 84394Help
Entry
84394             CDS       T01003                                 

Gene name
Dcx
Definition
(RefSeq) doublecortin
  KO
K16579  neuronal migration protein doublecortin
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    84394 (Dcx)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    84394 (Dcx)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Microtubule-associated proteins
     84394 (Dcx)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Microtubule-associated proteins (MAPs)
     84394 (Dcx)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DCX
Motif
Other DBs
NCBI-GeneID: 84394
NCBI-ProteinID: NP_445831
RGD: 620670
Ensembl: ENSRNOG00000047712
UniProt: G3V997
Position
Xq33-q34
AA seq 365 aa AA seqDB search
MELDFGHFDERDKASRNMRGSRMNGLPSPTHSAHCSFYRTRTLQALSNEKKAKKVRFYRN
GDRYFKGIVYAVSSDRFRSFDALLADLTRSLSDNINLPQGVRYIYTIDGSRKIGSMDELE
EGESYVCSSDNFFKKVEYTKNVNPNWSVNVKTSANMKAPQSLASSNSAQARENKDFVRPK
LVTIIRSGVKPRKAVRVLLNKKTAHSFEQVLTDITEAIKLETGVVKKLYTLDGKQVTCLH
DFFGDDDVFIACGPEKFRYAQDDFSLDENECRVMKGNPSATAGPKASPTPQKTSAKSPGP
MRRSKSPADSGNDQDANGTSSSQLSTPKSKQSPISTPTSPGSLRKHKDLYLPLSLDDSDS
LGDSM
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggaacttgattttggacattttgacgaacgagacaaagcatctagaaatatgagaggg
tcacggatgaatggacttccaagtcccactcatagtgctcactgtagcttctacagaacc
agaaccttgcaggcattaagtaatgagaagaaggccaagaaggtacgtttctaccgcaat
ggggaccgttacttcaaggggattgtgtacgctgtttcttctgaccgttttcgtagtttt
gatgcattgctggctgacctgactcgatccttgtccgacaacatcaacctgcctcaggga
gtgcgctacatttacactattgatggatccagaaagattggaagcatggatgaactggaa
gaaggggaaagctatgtctgttcctcagacaacttctttaaaaaggttgagtataccaag
aatgtcaatcccaactggtcggtcaatgtaaagacatcagccaacatgaaagcgccccag
tccttggctagcagcaacagtgctcaagccagagagaacaaggacttcgtgcgccccaaa
cttgtgaccatcattcgcagtggggtgaagcctcggaaggcggtgcgtgtgcttctcaac
aagaaaacagcccactctttcgagcaggtcctcactgacatcacagaagcgatcaaactg
gaaaccggagttgtcaaaaaactctatacccttgatggaaagcaggtcacctgtctccat
gatttctttggtgatgatgatgtgttcattgcttgtggccctgaaaagttccgctatgct
caagatgacttctccttggatgagaatgaatgcagagtcatgaaagggaatccatctgcc
acagctggcccaaaagcttccccaacacctcaaaagacatctgctaaaagcccaggccca
atgcgccgcagcaagtctccagctgactcaggtaacgaccaagacgcaaatggaacttct
agcagtcagctctcaacacctaagtcgaagcagtctcctatctctacacccacaagccct
ggaagtctgcggaagcacaaggacttgtacctgccactgtcattggatgactctgattca
cttggcgattccatgtga

DBGET integrated database retrieval system