KEGG   Rattus norvegicus (rat): 84395
Entry
84395             CDS       T01003                                 

Gene name
Slc34a2
Definition
(RefSeq) solute carrier family 34 member 2
  KO
K14683  solute carrier family 34 (sodium-dependent phosphate cotransporter)
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04928  Parathyroid hormone synthesis, secretion and action
rno04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    84395 (Slc34a2)
  09154 Digestive system
   04978 Mineral absorption
    84395 (Slc34a2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    84395 (Slc34a2)
   04147 Exosome [BR:rno04147]
    84395 (Slc34a2)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC34: Type II Na+-phosphate cotransporter
   84395 (Slc34a2)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   84395 (Slc34a2)
SSDB
Motif
Pfam: Na_Pi_cotrans
Other DBs
NCBI-GeneID: 84395
NCBI-ProteinID: NP_445832
RGD: 620889
Ensembl: ENSRNOG00000004626
UniProt: Q9JJ09
Position
14q11
AA seq 695 aa
MAPWPELENAHPNPNKFIEGASGPQSSIPDKDKGTSKTNDSGTPVAKIELLPSYSALVLI
EEPPEGNDPWDLPELQDNGIKWSERDSKGKILCIFQGIGKFILLLGFLYLFVCSLDVLSS
AFQLVGGKMAGQFFSNNSIMSNPVAGLVIGVLVTVMVQSSSTSSSIIVSMVASSLLSVRA
AIPIIMGANIGTSITNTIVALMQAGDRNEFRRAFAGATVHDFFNWLSVLVLLPLEAATHY
LEKLTNLVLETFSFQNGEDAPDILKVITDPFTKLIIQLDKKVIQQIAMGDSEAQNKSLIK
IWCKTISNVIEENVTVPSPDNCTSPSYCWTDGIQTWTIQNVTEKENIAKCQHIFVNFSLP
DLAVGIILLTVSLLILCGCLIMIVKLLGSVLRGQVATVIKKTLNTDFPFPFAWLTGYLAI
LVGAGMTFIVQSSSVFTSAMTPLIGIGVISIERAYPLTLGSNIGTTTTAILAALASPGNT
LRSSLQIALCHFFFNISGILLWYPIPFTRLPIRLAKGLGNISAKYRWFAVFYLIFFFLLT
PLTVFGLSLAGWPVLVGVGVPIILLILLVLCLRMLQARCPRILPLKLRDWNFLPLWMHSL
KPWDNIISLATSCFQRRCCCCCRVCCRVCCMVCGCKCCRCSKCCKNLEEEEKEQDVPVKA
SGGFDNTAMSKECQDEGKGQVEVLGMKALSNTTVF
NT seq 2088 nt   +upstreamnt  +downstreamnt
atggctccttggcccgagttggaaaatgcccaccccaaccccaataaattcatcgaaggg
gcctcaggtccacagtctagcataccagacaaagacaaggggaccagcaaaacaaatgac
agcgggactcctgtagccaagattgaacttctaccctcatattccgccctggttctcata
gaggagccccctgaggggaacgacccctgggacctgcctgaactccaagacaatgggatc
aaatggtcagagagagactccaaagggaagattctctgcattttccaggggattgggaaa
ttcatccttctcctggggtttctctacttgtttgtgtgctccctggatgtactcagtagt
gccttccagcttgttggaggaaaaatggccggccagttcttcagcaacaactccattatg
tctaatcctgtggctggacttgtgataggggtgctggtgacagtcatggtgcaaagctcc
agcacgtcctcgtcaatcatcgtcagcatggttgcctcctccttgctgtcagtccgcgct
gccatccccatcatcatgggtgctaacatcgggacctccatcaccaacacgattgtggca
cttatgcaggcaggagacagaaatgagttcagaagggcatttgcaggagctactgtccat
gacttcttcaactggctctctgtgttggtgctcttacctctggaggctgccacccattac
ctggagaaactgaccaaccttgtgttggaaaccttcagcttccagaatggagaagatgcc
ccagacattctgaaagtcataacagaccccttcacaaagctcatcatccagctggataaa
aaagtcatccaacaaattgcaatgggtgactcagaagcccagaacaagagcctgatcaag
atctggtgtaaaactataagcaatgtgattgaggagaatgtcactgtcccctcgcctgat
aactgcacctctccttcatattgctggactgatggcatacagacctggaccatccagaat
gtgaccgagaaggagaacattgctaaatgccagcacatcttcgtgaatttcagcctccca
gacctcgctgtgggcatcatcctgctcactgtctccctgctgatcctttgcggctgtctg
atcatgattgtcaaactgttgggttctgtgctcaggggacaggttgccactgtcatcaag
aagacccttaatactgatttcccctttccctttgcctggctgactggctacctggccatc
cttgtgggggcaggcatgaccttcatagtgcaaagcagctctgtgttcacttctgccatg
acgccactcatcggtattggggtgatcagcatcgagagggcatatccactcacgctgggc
tccaacattggcaccaccacgactgccattctggctgccttggccagcccaggcaacaca
ttgaggagttccctccagattgccctgtgccattttttcttcaacatctctggaatattg
ctgtggtacccaatcccattcacccgtctgcccatccgtctggctaaaggcctgggcaac
atctctgccaagtatcgctggttcgcagtcttctatctcatcttcttcttcctcctgacc
ccgctgacagtgtttggcctgtccctggctggctggccagtgctggtgggcgtgggtgtg
cccatcattctgctgatcctcctggtcctgtgcctccggatgctgcaggcccgctgccct
cgcatcctgcccctgaagctccgggactggaatttcctacccttgtggatgcactctctg
aaaccctgggacaacatcatctccctggccacctcctgcttccagaggcgctgttgctgc
tgttgccgtgtgtgctgccgtgtctgctgcatggtgtgtggctgcaagtgctgccgctgc
agcaagtgctgcaagaacctggaggaggaggaaaaggagcaggacgtcccagtcaaggct
tctgggggctttgacaatacagctatgagcaaagaatgccaagatgagggcaagggccaa
gtggaagttctgggcatgaaggccctgtccaacactacagtgttctag

DBGET integrated database retrieval system