KEGG   Rattus norvegicus (rat): 84396Help
Entry
84396             CDS       T01003                                 

Gene name
Atp1b4, Ac2-628
Definition
(RefSeq) ATPase Na+/K+ transporting family member beta 4
  KO
K01540  sodium/potassium-transporting ATPase subunit beta
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04022  cGMP-PKG signaling pathway
rno04024  cAMP signaling pathway
rno04260  Cardiac muscle contraction
rno04261  Adrenergic signaling in cardiomyocytes
rno04911  Insulin secretion
rno04918  Thyroid hormone synthesis
rno04919  Thyroid hormone signaling pathway
rno04925  Aldosterone synthesis and secretion
rno04960  Aldosterone-regulated sodium reabsorption
rno04961  Endocrine and other factor-regulated calcium reabsorption
rno04964  Proximal tubule bicarbonate reclamation
rno04970  Salivary secretion
rno04971  Gastric acid secretion
rno04972  Pancreatic secretion
rno04973  Carbohydrate digestion and absorption
rno04974  Protein digestion and absorption
rno04976  Bile secretion
rno04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    84396 (Atp1b4)
   04022 cGMP-PKG signaling pathway
    84396 (Atp1b4)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    84396 (Atp1b4)
   04918 Thyroid hormone synthesis
    84396 (Atp1b4)
   04919 Thyroid hormone signaling pathway
    84396 (Atp1b4)
   04925 Aldosterone synthesis and secretion
    84396 (Atp1b4)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    84396 (Atp1b4)
   04261 Adrenergic signaling in cardiomyocytes
    84396 (Atp1b4)
  09154 Digestive system
   04970 Salivary secretion
    84396 (Atp1b4)
   04971 Gastric acid secretion
    84396 (Atp1b4)
   04972 Pancreatic secretion
    84396 (Atp1b4)
   04976 Bile secretion
    84396 (Atp1b4)
   04973 Carbohydrate digestion and absorption
    84396 (Atp1b4)
   04974 Protein digestion and absorption
    84396 (Atp1b4)
   04978 Mineral absorption
    84396 (Atp1b4)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    84396 (Atp1b4)
   04961 Endocrine and other factor-regulated calcium reabsorption
    84396 (Atp1b4)
   04964 Proximal tubule bicarbonate reclamation
    84396 (Atp1b4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    84396 (Atp1b4)
CD molecules [BR:rno04090]
 Proteins
  84396 (Atp1b4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Na_K-ATPase MTABC_N Paf1
Motif
Other DBs
NCBI-GeneID: 84396
NCBI-ProteinID: NP_445833
RGD: 620994
Ensembl: ENSRNOG00000007059
UniProt: Q9R193
Position
Xq35
AA seq 356 aa AA seqDB search
MRRQLRSRRAPAFPYGYRYRLDDQDEMNHNYLADEEEEAEEEAQVMMVPGLEEEEEEEEG
KEEEEEREEEEGQGQSTGNAWWRKLQIVNEYLWDPEKRMSLARTGQSRSLILVIYFFFYA
SLAAVITLFIYMLFLAISPYMPTFTEQVKPPGVMIRPFAHSLNFNFNVSEPETWQRYVIS
LNGFLQGYNDSLQEEMNIDCPPGQYFIQDGDEDEDKKACQFKRSFLKNCSGLEDPTFGYS
TGQPCILLKMNRIVGFRPEFGDPVKVSCKVQKGDENDIRSINYYPESASFDLRYYPYYGK
LTHVNYTSPLVAMHFTDVVKNQEVPVQCQLKGKGIVNDVINDRFVGRIIFTLNIET
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgagacggcaactccgctccagaagggcgccggcctttccttatggttaccgctacaga
cttgatgatcaggatgaaatgaatcacaactacttagcggacgaagaggaggaagcagaa
gaagaggctcaggtgatgatggtgcctggtctggaggaagaggaagaagaggaggaagga
aaagaggaggaggaagaaagggaggaagaagaaggtcagggtcagtcaacaggcaatgcc
tggtggcggaaattgcagatcgtgaatgaatacctgtgggacccggagaaaaggatgtct
ctggcccgaacaggtcagagtcggagtcttattttagtcatttacttcttcttctatgcc
tccctggctgccgtgatcaccctattcatatatatgctgttcctagccatcagtccttac
atgccgaccttcacggagcaggtgaaacctcctggagttatgatcagacccttcgctcat
agccttaacttcaacttcaacgtttctgaacctgaaacttggcagcgttatgtcattagc
ctaaatggctttctccagggctataatgacagtcttcaagaggaaatgaatatagattgt
cctcccggtcagtacttcatccaagatggagatgaagatgaggacaagaaggcctgccaa
tttaaacgctccttcctgaagaattgctctgggctggaggaccccacttttggatattct
actggacagccttgcatccttctcaagatgaaccggattgtaggctttcgtcctgaattt
ggagatcctgtgaaggtgtcctgcaaagttcagaaaggtgatgaaaacgacattcgatcc
atcaattactacccggagtcagcttcttttgacctccgctactacccttactatggcaaa
ctgactcacgttaactacacctccccgctggtggcaatgcattttacagacgtggtgaag
aaccaagaagtgcctgtacagtgccagctgaagggcaaaggcatcgtaaatgacgtcatc
aatgatcgtttcgtcgggaggataatctttaccctgaacatagaaacctag

DBGET integrated database retrieval system