KEGG   Rattus norvegicus (rat): 84397
Entry
84397             CDS       T01003                                 

Gene name
Tnfaip6, Tnfip6
Definition
(RefSeq) TNF alpha induced protein 6
  KO
K19018  tumor necrosis factor-inducible gene 6 protein
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    84397 (Tnfaip6)
Glycosaminoglycan binding proteins [BR:rno00536]
 Hyaluronan
  Extracellular matrix or blood plasma proteins
   84397 (Tnfaip6)
SSDB
Motif
Pfam: CUB Xlink
Other DBs
NCBI-GeneID: 84397
NCBI-ProteinID: NP_445834
RGD: 621359
Ensembl: ENSRNOG00000050792
UniProt: B0BN34
Position
3q12
AA seq 275 aa
MVFLLCLCVLLWEEAHGWGFKNGIFHNSIWLEQAAGVYHREARAGRYKLTYAEAKAVCEY
EGGRLATYKQLEAARKIGFHVCAAGWMAKGRVGYPIVKPGPNCGFGKTGIIDYGIRLNRS
ERWDAYCYNPNAKECGGVFTDPKRIFKSPGFPNEYDDNQVCYWHIRLKYGQRIHLSFLDF
DLEHDPGCLADYVEIYDSYDDVHGFVGRYCGDELPEDIISTGNVMTLKFLSDASVTAGGF
QIKYVTVDPAPKSNQGKNTTMTGNKKFLAGRFSHL
NT seq 828 nt   +upstreamnt  +downstreamnt
atggtcttcctcctttgcttatgcgtcttgctgtgggaagaggctcacggatggggattc
aagaatggaatctttcataattccatatggcttgaacaagcagcaggcgtataccataga
gaagcccgggctggcagatacaagctaacctatgcagaagccaaggcggtatgtgaatat
gaaggtggccgtcttgcaacctacaagcagctagaagcagccagaaagattggattccat
gtctgtgctgctgggtggatggccaagggtagagttgggtaccccattgtgaaacctggg
cccaactgtggatttggcaaaaccggcatcattgattatggaatccggctcaacaggagc
gagcggtgggacgcctattgctacaacccgaacgcaaaggagtgtggtggtgtctttaca
gacccgaagcgaatctttaaatccccaggcttcccaaatgagtatgacgacaaccaggtt
tgctactggcacatccggctcaagtacggtcagcgaattcacctgagctttttggacttt
gaccttgaacatgatccaggctgtttggctgactatgtagaaatatatgacagttatgac
gatgtccacggctttgtaggaagatactgcggtgatgaacttccagaagacatcatcagc
acaggaaatgtcatgaccttgaagtttctgagtgatgcgtccgtcacagccggaggcttc
cagattaaatacgtcacagtggatcctgcacctaaatccaatcaaggcaaaaatacaact
atgactggaaataaaaagttcttagctggacggtttagccatctataa

DBGET integrated database retrieval system