KEGG   Rattus norvegicus (rat): 84399Help
Entry
84399             CDS       T01003                                 

Gene name
Ihh
Definition
(RefSeq) Indian hedgehog
  KO
K11989  indian hedgehog
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04340  Hedgehog signaling pathway
rno05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    84399 (Ihh)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    84399 (Ihh)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    84399 (Ihh)
Peptidases and inhibitors [BR:rno01002]
 Cysteine peptidases
  Family C46: hedgehog family
   84399 (Ihh)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HH_signal Hint Peptidase_M15_3
Motif
Other DBs
NCBI-GeneID: 84399
NCBI-ProteinID: NP_445836
RGD: 620021
Ensembl: ENSRNOG00000018059
UniProt: F1LP42
Position
9q33
AA seq 411 aa AA seqDB search
MSPAWLRPRLRFCLLLLLLLLVPAARGCGPGRVVGSRRRPPRKLVPLAYKQFSPNVPEKT
LGASGRYEGKIARSSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDRLNSLAISVMN
QWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRNKYGLLARLAVEAGFDWVYY
ESKAHVHCSVKSEHSAAAKTGGCFPAGAQVHLETGERVALSAVKPGDRVLAMGEDGNPTF
SDVLIFLDREPNRLRAFQVIETQDPPRRLALTPAHLLFIADNHTEPAARFRATFASHVQP
GQYVLVAGVPGLQPARVAAISTHVALGSYAPLTRHGTLVVEDVVASCFAAVSDHHLAQLA
FWPLRLFPSLPWGSWTPSEGVHWYPQLLYRLGRLLLEESTFHPLGMSGAGS
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgtctcccgcctggctccggccccgactgcgcttctgtctgctcctgctgctgctgctt
ctggtgccggcggcgcggggctgcgggccgggccgggtggtgggcagccgccggaggccg
cctcgtaaactcgtgcctcttgcctacaagcagttcagccccaacgtgccggagaagacc
ctgggcgccagcgggcgctacgaaggcaagatcgcgcgcagctctgagcgcttcaaggag
ctcacccccaactacaatcccgacatcatcttcaaagacgaggagaacaccggtgccgac
cgcctcatgacccagcgctgcaaggaccgtctgaactcactggccatctctgtcatgaac
cagtggccgggtgtgaagctgcgggtgacggaaggctgggatgaagacggccatcactca
gaggaatctttacactatgagggccgcgcggtggatatcaccacctcagaccgcgaccga
aataagtacggactactggcgcgcttagcagtggaggccggcttcgactgggtgtattac
gagtccaaggcccacgttcattgctctgtcaagtctgagcactcggctgctgccaagaca
ggtggctgctttcctgccggagcccaggtccacctagaaactggggagcgtgtggccctg
tcagctgtgaagccaggagaccgggtcctggccatgggggaagatggcaaccccaccttc
agcgatgtgctcattttcctggaccgtgagccaaacaggctgagagctttccaggtcatc
gagactcaggatcctccacgtcggctggcactcacgcctgcccacctgctcttcattgcg
gacaatcatacagaaccagcagcccgcttccgggccacgtttgccagccacgtgcagcca
ggccaatatgtgctggtagcaggggtcccaggcctccagcctgctcgggtggcagccatc
tccacccacgtggcccttgggtcctatgctcctctcacgaggcacgggacactcgtggtg
gaggatgtggtagcctcctgcttcgcagctgtgtctgaccaccatctggctcagttggcc
ttctggcccctgcgactgtttcccagcttgccatggggcagctggaccccaagtgaaggt
gttcactggtaccctcagctgctctaccgcctggggcgtctcttgctagaagagagcacc
ttccatccactgggcatgtctggggcaggaagctga

DBGET integrated database retrieval system