KEGG   Rattus norvegicus (rat): 84400Help
Entry
84400             CDS       T01003                                 

Gene name
Prelp
Definition
(RefSeq) proline and arginine rich end leucine rich repeat protein
  KO
K08125  proline arginine-rich end leucine-rich repeat protein
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:rno00535]
    84400 (Prelp)
Proteoglycans [BR:rno00535]
 Extracellular matrix (ECM) proteoglycans
  Small leucine-rich proteoglycan (SLRP) family
   class II
    84400 (Prelp)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_8 LRR_4 LRR_1 LRR_9 LRRNT
Motif
Other DBs
NCBI-GeneID: 84400
NCBI-ProteinID: NP_445837
RGD: 620226
Ensembl: ENSRNOG00000003120
Vega: OTTRNOG00000000638
UniProt: Q9EQP5
Position
13q13
AA seq 377 aa AA seqDB search
MRASFFWFLPLLLILASVAQGQPRPKPGIRRKPKPRPTPSFPQPHEPAEPTDLPPPLPPG
PPSVFPDCPRECYCPPDFPSALYCDSRNLRKVPIIPPRIHYLYLQNNFITELPVESFKNA
TGLRWINLDNNRIRKVDQRVLEKLPGLAFLYMDKNQLEEVPSALPRNLEQLRLSQNLISR
IPPGVFSKLENLLLLDLQHNRLSDGVFKADTFQGLKNLMQLNLAHNILRRMPPKVPPAIH
QLYLDSNKIETIPSGYFKDFPNLAFIRMNYNKLSDRGLPKNSFNISNLLVLHLSHNKISN
VPAISNKLEHLYLNNNSIEKINGTQICPSNLVAFHDFSSDLENVPHLRYLRLDGNFLKPP
IPLDLMMCFRLLQSVVI
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgagggcatccttcttctggttccttccacttctcctcatcttggcctcagtggcccaa
ggccagccaagaccaaaacctgggattaggcgtaaacccaagccaaggcccacacccagc
tttcctcagccccacgagccagcagagcccacagacctgcctccaccccttcctcctggc
cctccatctgtcttccctgactgtccacgggaatgctactgcccgcctgacttcccatca
gccctctactgtgacagccgaaaccttcgcaaggtcccaatcatcccaccccgaattcac
tacctttatctgcagaacaacttcatcaccgagctccccgtagaatctttcaaaaatgcc
acaggcctcaggtggatcaacctggacaacaaccgcattcgcaaggtggaccagagagtg
ctggagaagctccctggcctggcattcctctacatggacaagaaccagctggaagaggtg
ccatcagctctgccccggaacctggaacagctgaggctaagccagaacctcatctccagg
atcccgcccggagtattcagcaagcttgagaaccttctgcttctggatctgcagcacaat
aggctgagcgacggagtcttcaaagccgacaccttccagggcctcaagaacctcatgcaa
ctcaatctggcccacaacatcctgagaaggatgccccccaaggtgcccccggccattcac
cagctctacctggacagcaataagatcgagaccattcccagcggatacttcaaggacttc
cccaaccttgccttcatccgcatgaactacaacaagctgtcggatcgagggctccccaag
aactccttcaacatctccaacttgctggtgctccacttgtcacacaacaagatcagcaat
gtgccggccatcagcaacaagctggaacacctgtacctcaacaacaatagcatagagaag
atcaatgggacccagatttgccccagcaacctagtggccttccatgacttctcctcggat
ctggaaaacgtgccacacctgcgctacctgcggctggatgggaatttcctgaagccaccc
atcccgttggacctcatgatgtgcttccgcctcctgcagtctgtggttatctag

DBGET integrated database retrieval system