KEGG   Rattus norvegicus (rat): 84407Help
Entry
84407             CDS       T01003                                 

Gene name
Cdh11
Definition
(RefSeq) cadherin 11
  KO
K06803  cadherin 11, type 2, OB-cadherin
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:rno04515]
    84407 (Cdh11)
Cell adhesion molecules [BR:rno04515]
 Cadherins
  Major cadherins
   84407 (Cdh11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cadherin Cadherin_C ASFV_J13L
Motif
Other DBs
NCBI-GeneID: 84407
NCBI-ProteinID: NP_445844
RGD: 619742
Ensembl: ENSRNOG00000013481
UniProt: F1MAH6
Position
19p14
AA seq 796 aa AA seqDB search
MKENYCLQAALVCLSMLYHSQAFALERRSHLRPSFHGHHEKGKEGQVLQRSKRGWVWNQF
FVIEEYTGPDPVLVGRLHSDIDSGDGNIKYILSGEGAGTIFVIDDKSGNIHATKTLDREE
RAQYTLMAQAVDRDTNRPLEPPSEFIVKVQDINDNPPEFLHETYHANVPERSNVGTSVIQ
VTASDADDPTYGNSAKLVYSILEGQPYFSVEAQTGIIRTALPNMDREAKEEYHVVIQAKD
MGGHMGGLSGTTKVTITLTDVNDNPPKFPQSVYQMSVSEAAVPGEEVGRVKAKDPDIGEN
GLVTYNIVDGDGMELFEITTDYETQDGVVKLKKPVDFETKRAYSLKVEAANVHIDPKFIS
NGPFKDTVTVKIAVEDADEPPMFLAPSYIHEVQENAAAGTVVGRVHAKDPDAANSPIRYS
IDRHTDLDRFFTINPEDGFIKTTKPLDREETAWLNISVFAAEIHNRHQEAKVPVAIRVLD
VNDNAPKFAAPYEGFICESDHPKPLSNQPIVTVSADDLDDTANGPRFIFSLPPEIIHNPN
FTVRDNRDNTAGVYARRGGFSRQKQDLYLLPIVISDGGIPPMSSTNTLTIKVCGCDVNGA
LLSCNAEAYILNAGLSTGALIAILACIVILLVIVVLFVTLRRQKKEPLIVFEEEDVRENI
ITYDDEGGGEEDTEAFDIATLQNPDGINGFIPRKDIKPEYQYMPRPGLRPAPNSVDVDDF
INTRIQEADNDPTAPPYDSIQIYGYEGRGSVAGSLSSLESATTDSDLDYDYLQNWGPRFK
KLADLYGSKDTFDDDS
NT seq 2391 nt NT seq  +upstreamnt  +downstreamnt
atgaaggagaactactgtttacaagctgccctggtgtgcctgagcatgctataccacagc
caggcatttgccctggagcgacgaagccacctgcgtccctcattccatggacatcatgag
aagggcaaggagggacaggtgctgcaacgctccaagagaggttgggtctggaaccagttc
tttgtgatagaagagtacaccgggcctgaccctgtgcttgtgggcaggcttcattctgac
attgactctggtgatgggaacattaaatacattctctcaggtgaaggagcaggaaccatt
tttgtgattgatgacaaatcagggaacattcacgccaccaagacactggaccgagaggag
agagcccagtatacactgatggctcaggcggtggacagggacaccaacaggccattggaa
ccaccttcagaatttatcgttaaggtccaggacattaatgacaaccctccagagtttctg
catgaaacctatcatgccaatgtgcctgagaggtccaatgtgggaacttcagtaatccaa
gtgacagcctctgatgcagatgatcccacctatggaaatagtgccaagttagtgtatagt
atccttgaaggacaaccctacttctcagtggaggcccaaacaggtatcatcagaacagcc
cttcccaatatggacagagaagccaaggaggagtaccatgtggtgatccaggccaaggac
atgggtggacacatgggcggactctcagggacaaccaaagtgacgatcacactgactgat
gtcaatgacaacccaccaaagtttccacagagcgtgtaccagatgtctgtttcagaagca
gctgtcccgggggaggaagtaggaagggtgaaggctaaagacccagacatcggagaaaat
ggcttagtcacatacaatatcgttgatggagatggcatggaactgtttgaaatcacaaca
gactatgaaacacaggatggtgtggtgaagctgaaaaagcctgtagattttgaaaccaaa
agagcatatagcttgaaggtagaggcggccaatgtacacattgatccgaagttcatcagc
aatggacctttcaaggacacagtgactgtcaagattgcagtagaagatgccgacgagcct
cccatgttcttggccccaagttatatccatgaagttcaagaaaatgcagctgctggcact
gtggttgggagagtacatgccaaagacccggatgctgccaacagcccaataaggtattca
attgatcgtcatactgacctcgacaggtttttcacgattaatccagaagacggttttatt
aaaactacgaaacctctagatagggaagaaactgcctggctcaacatctctgtctttgca
gcagaaatccacaacagacatcaggaagccaaagtcccagtggccatcagggtcctggat
gtcaatgacaatgctcctaagtttgctgccccttatgaaggctttatctgtgagagtgat
caccccaaaccactctccaaccagccaatagttacagttagtgcagatgacctggatgac
acagccaatggaccaagatttatcttcagtctaccccctgaaatcattcacaacccaaat
ttcacagtaagagacaacagagataacactgcaggagtatatgcccgacgtggagggttc
agtcggcagaagcaggacctctacctcctgcccattgtgattagcgatggtggcatccca
cctatgagtagcaccaataccctcactataaaagtctgtgggtgtgatgtgaatggggca
ctgttgtcctgtaacgctgaagcctacatcctgaatgccggtctgagcactggggcattg
atcgccatccttgcctgcatcgtcattcttctggtcatcgttgtgttgtttgtgaccctg
aggaggcaaaagaaagaaccactcattgtatttgaagaagaggatgtccgggagaacatc
ataacctatgatgatgaagggggtggtgaggaagacaccgaagccttcgacattgccacc
ctgcagaatcctgacggtatcaatggatttatccctcgcaaagatatcaaacctgagtat
cagtacatgcctagacctgggctgcgaccagcacccaacagtgtggatgtggacgacttc
atcaacacaagaatacaggaggccgataatgatcccacggcccctccctatgactccatc
caaatctatggttatgagggcaggggttccgtggctgggtccctgagctccttggagtct
gccaccacagattcggacctggactacgactatctacagaactggggacctcgttttaag
aaattagcagacttgtatggctccaaagacacttttgatgatgactcttaa

DBGET integrated database retrieval system