KEGG   Rattus norvegicus (rat): 84416
Entry
84416             CDS       T01003                                 

Gene name
Smpx
Definition
(RefSeq) small muscle protein, X-linked
  KO
K24209  small muscular protein
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    84416 (Smpx)
SSDB
Motif
Pfam: Chisel
Other DBs
NCBI-GeneID: 84416
NCBI-ProteinID: NP_445847
RGD: 69233
Ensembl: ENSRNOG00000007495
Vega: OTTRNOG00000000762
UniProt: Q925F0
Position
Xq21
AA seq 85 aa
MSKQPISNVRSIQANINIPMGAFRPGAGQPPRRKESTPGTAEGAPATPEEKKPVPGMKKF
PGPVVNLSEIQNVKSELKYVPKGEQ
NT seq 258 nt   +upstreamnt  +downstreamnt
atgtcgaagcagccaatttccaacgtcagatccattcaggccaatattaatattccaatg
ggagcctttcgtccgggagctgggcagcctcccagaaggaaagagagtacccctggaact
gcggagggagcacctgctactcccgaggaaaagaagccagttcctggaatgaagaaattc
ccaggacccgtcgtcaacctgtctgagatccaaaacgttaaaagtgaactaaaatacgtc
cccaaaggtgaacagtag

DBGET integrated database retrieval system