KEGG   Rattus norvegicus (rat): 84422
Entry
84422             CDS       T01003                                 

Gene name
Gfra3
Definition
(RefSeq) GDNF family receptor alpha 3
  KO
K19895  GDNF family receptor alpha
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
    84422 (Gfra3)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
 Receptors
  84422 (Gfra3)
SSDB
Motif
Pfam: GDNF
Other DBs
NCBI-GeneID: 84422
NCBI-ProteinID: NP_445850
RGD: 620502
Ensembl: ENSRNOG00000020309
UniProt: Q6AXR3
Position
18p12
AA seq 397 aa
MGLSRSPRPPPLVILLLVLSLWLPLGTGNSLPTENRLVNSCTQARKKCEANPACKAAYQH
LDSCTPSLSSPLPSGESATSAACLEAAQQLRNSSLIDCRCHRRMKHQATCLDIYWTVHPV
RSLGDYELDVSPYEDTVTSKPWKMNLSKLSMLKPDSDLCLKFAMLCTLNDKCDRLRKAYG
EACSGIRCQRHLCLAQLRSFFEKAAESHAQGLLLCPCAPEDAGCGERRRNTIAPSCALPS
VAPNCLDLRSFCRADPLCRSRLMDFQTHCHPMDILGTCATEQSRCLRAYLGLIGTAMTPN
FISKVNTTVALGCTCRGSGNLQDECEQLEKSFSQNPCLMEAIAAKMRFHRQLFSQDWADS
TFSVMQQQNSSPALRPQLRLPVLSFFILTLILLQTLW
NT seq 1194 nt   +upstreamnt  +downstreamnt
atggggctctcccggagcccgcgaccgccgccgctagtgatcctgctactggtgctgtcg
ctgtggctaccccttggaacaggaaactcccttcccacagagaacaggcttgtgaacagc
tgtacccaggccagaaaaaaatgcgaggctaatcccgcttgcaaggctgcctaccagcac
ctggactcctgcacccccagtctcagcagtccactgccctcaggggagtctgccacatct
gcagcgtgccttgaagcagcacagcaactcaggaacagctctctcatagactgcaggtgc
caccggcgcatgaagcaccaagctacctgtctggacatttattggaccgttcaccctgtc
cgaagccttggtgactacgagttggacgtctcaccctatgaagacacagtgaccagcaaa
ccctggaaaatgaatctcagcaagctgagcatgctcaaaccagactccgacctctgcctc
aaatttgctatgctgtgtactcttaacgacaagtgcgaccgcctccgaaaggcctacggg
gaggcgtgctcagggatccgctgccagcgccacctctgcctagctcagctgcgctccttc
ttcgagaaggcggcagagtcccacgctcagggcctgctgctgtgtccctgtgcacccgaa
gatgcgggctgtggggagcgccggcgcaacaccatcgcccccagttgcgccctcccgtct
gtggcccccaactgcctagatcttcggagcttctgccgtgcggaccctctgtgcagatca
cgcctgatggacttccagacccactgccaccctatggacatcctcgggacttgtgcaact
gagcagtccagatgtctgcgggcatacctggggctaattgggactgccatgaccccaaac
ttcatcagcaaggtcaacactactgttgccttaggctgtacctgccgaggcagtggcaac
ctgcaggacgagtgtgaacagctggaaaagtccttctcccagaacccctgcctcatggag
gccattgcggctaaaatgcgtttccacagacaactcttctcccaggactgggcggactct
actttttctgtgatgcagcagcagaacagcagccctgctctgaggccccagctcaggcta
cccgttctgtctttcttcatccttaccttgattctgctgcagaccctctggtaa

DBGET integrated database retrieval system