KEGG   Rattus norvegicus (rat): 84423
Entry
84423             CDS       T01003                                 

Gene name
Nrtn
Definition
(RefSeq) neurturin
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: TGF_beta
Other DBs
NCBI-GeneID: 84423
NCBI-ProteinID: NP_445851
RGD: 621494
Ensembl: ENSRNOG00000048651
UniProt: Q811Q5
Position
9q12
AA seq 195 aa
MRCWKAAALVSLICSSLLSVWMCQEGLLLGHRLGPALAPLRRPPRTLDARIARLAQYRAL
LQGAPDAVELRELSPWVARPSGPRRRAGPRRRRARPGSRPCGLRELEVRVSELGLGYTSD
ETVLFRYCAGACEAAIRIYDLGLRRLRQRRRVRKERVRAHPCCRPTAYEDEVSFLDVHSR
YHTLQELSARECACV
NT seq 588 nt   +upstreamnt  +downstreamnt
atgaggtgctggaaggcggcggccctggtgtcgctcatctgcagctccctgctgtctgtc
tggatgtgccaggagggtctgctcttgggtcaccgcctgggacccgcgctcgctcctctg
cgacgccctccacgcaccctggacgcccgcatcgcccgcctggcccagtatcgcgctctg
ctgcagggcgcccccgacgcggtggagcttcgagaactttctccctgggttgcccgtccc
tcggggccgcgccgtcgagcgggtccccggcgtcggcgtgcgcggccaggctcgcgaccg
tgcgggctgcgcgagctcgaggtgcgtgtgagcgagctgggtctgggctacacgtcggac
gaaaccgtcctgttccgctactgcgcaggcgcgtgcgaggcggccatacgcatctacgac
ctgggcctgcggcgcctgcgccagcgacgacgcgtgcgcaaagagcgggtgcgagcgcac
ccgtgctgccgcccgacggcctacgaggacgaggtgtccttcctggacgtacacagccgc
taccacacgctgcaagagctgtcggcgcgggagtgcgcgtgcgtgtga

DBGET integrated database retrieval system