KEGG   Rattus norvegicus (rat): 84424Help
Entry
84424             CDS       T01003                                 

Gene name
Tle3, Esp3
Definition
(RefSeq) transducin-like enhancer of split 3
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: TLE_N WD40 ANAPC4_WD40 HALZ Ribosomal_S18
Motif
Other DBs
NCBI-GeneID: 84424
NCBI-ProteinID: NP_445852
RGD: 620292
Ensembl: ENSRNOG00000013013
UniProt: Q9JIT3
Position
8q24
AA seq 764 aa AA seqDB search
MYPQGRHPAPHQPGQPGFKFTVAESCDRIKDEFQFLQAQYHSLKVEYDKLANEKTEMQRH
YVMYYEMSYGLNIEMHKQTEIAKRLNTILAQIMPFLSQEHQQQVAQAVERAKQVTMTELN
AIIGQQQLQAQHLSHATHGPPVQLPPHPSGLQPPGIPPVTGSSSGLLALGALGSQAHLAV
KDEKNHHELDHRERESSTNNSVSPSESLRASEKHRGSADYSMEAKKRKAEEKDSLSRYDS
DGDKSDDLVVDVSNEDPATPRVSPAHSPPENGLDKARGLKKDAPTSPASVASSSSTPSSK
TKDLGHNDKSSTPGLKSNTPTPRNDAPTPGTSTTPGLRSMPGKPPGMDPIASALRTPISL
TSSYAAPFAMMSHHEMNGSLTSPSAYAGLHNIPSQMSAAAAAAAAAYGRSPMVGFDPHPP
MRATGLPSSLASIPGGKPAYSFHVSADGQMQPVPFPHDALAGPGIPRHARQINTLSHGEV
VCAVTISNPTRHVYTGGKGCVKIWDISQPGSKSPISQLDCLNRDNYIRSCKLLPDGRTLI
VGGEASTLTIWDLASPTPRIKAELTSSAPACYALAISPDAKVCFSCCSDGNIAVWDLHNQ
TLVRQFQGHTDGASCIDISHDGTKLWTGGLDNTVRSWDLREGRQLQQHDFTSQIFSLGYC
PTGEWLAVGMESSNVEVLHHTKPDKYQLHLHESCVLSLKFAYCGKWFVSTGKDNLLNAWR
TPYGASIFQSKESSSVLSCDISADDKYIVTGSGDKKATVYEVIY
NT seq 2295 nt NT seq  +upstreamnt  +downstreamnt
atgtatccgcaaggcagacatccggcaccccatcaacccgggcagccaggatttaaattc
actgtggccgagtcctgtgacaggatcaaagacgaattccagttcctgcaagctcagtat
cacagcctcaaagtggagtacgacaagctggcgaacgagaagacagagatgcagcgccat
tatgtgatgtactatgagatgtcctacggcttgaatatcgaaatgcacaagcagacagag
atcgcgaagagactgaacacgattctagcccagatcatgccttttttgtcacaggagcat
cagcagcaagtggcgcaggctgtggaacgcgccaagcaggtcaccatgacggagctgaac
gccatcatcgggcagcagcaactccaggcacagcacctctcccatgccacacatggtccc
ccggtccagctgccaccccacccgtcaggcctccaacctcctgggattcccccagtgaca
ggaagcagctctgggttgctggcacttggtgccctgggaagccaagcccacttggcagtg
aaggatgagaagaaccatcatgaactggatcacagagagagagagtccagcacgaacaat
tctgtgtcaccctcagaaagcctccgggccagtgagaagcaccggggctctgcagactac
agcatggaagccaagaagcggaaagcggaagagaaagacagcctgagccgatacgacagc
gatggggacaagagtgatgacctggtagtggatgtctccaatgaggacccagcgacaccc
cgggtgagcccagcacactcccctcctgaaaatgggctggacaaagcccgaggtctgaag
aaagacgcccccaccagcccagcctctgtggcttcctccagcagcacgccttcctccaag
accaaagaccttggtcataatgacaaatcttccacacctgggctcaagtccaacacacca
acgccaaggaacgatgccccaactccaggcaccagcaccaccccggggctccggtcaatg
ccgggcaaacctccaggcatggacccgatagcctcggccctgcgcacacccatctccctc
accagctcctatgcagcaccctttgccatgatgagccaccacgagatgaatggctccctc
accagcccaagcgcctatgctggcctacacaacatcccatcccagatgagcgccgccgca
gcagctgcagccgccgcctatggccgatcgccaatggttggttttgaccctcatcccccg
atgcgggccacaggcctgccctccagtcttgcctccattcctggagggaaaccggcgtac
tccttccatgtgagtgccgacgggcagatgcaacctgtgcccttcccccatgatgcgcta
gcaggccccggcattcccaggcatgcccggcagatcaacacactcagccatggggaggtg
gtatgtgccgtgaccatcagcaaccccacgaggcacgtctacacaggcggcaagggctgt
gtgaagatatgggacatcagccagccgggcagcaagagtcccatctcccagctggactgc
ctgaacagggacaactacatccgctcatgcaagcttctccctgatgggcgcacgctcatt
gtgggtggtgaggccagcacactcaccatctgggacctggcctcgcccacgccccgcatc
aaggctgagctgacgtcctcggctccagcctgttacgccctggccatcagtcctgatgcc
aaagtctgtttctcctgctgcagtgatgggaacattgcagtttgggatctgcacaaccag
accctggtcaggcagttccagggccacacggatggggccagctgtatagacatctctcat
gatggcactaaactgtggaccgggggcctggacaacactgtgcgctcctgggacctgcgt
gaagggcggcagctacagcaacacgacttcacctcccagatcttctccctgggttactgc
cccactggggagtggctcgccgtgggcatggagagcagcaacgtagaggttctgcaccac
accaagccggacaagtaccaactgcatctgcacgagagctgcgtgctgtccctcaagttt
gcctactgtggcaagtggtttgtgagcactgggaaagacaaccttctcaatgcctggagg
acgccttacggagccagcatcttccagtctaaagaatcctcgtccgtcttgagctgtgat
atttcagcggatgacaaatatattgtaacgggctctggtgacaagaaggccacagtttac
gaggtcatctactga

DBGET integrated database retrieval system