KEGG   Rattus norvegicus (rat): 84431Help
Entry
84431             CDS       T01003                                 

Gene name
Asah1, Asah
Definition
(RefSeq) N-acylsphingosine amidohydrolase 1
  KO
K12348  acid ceramidase [EC:3.5.1.23]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00600  Sphingolipid metabolism
rno01100  Metabolic pathways
rno04071  Sphingolipid signaling pathway
rno04142  Lysosome
Module
rno_M00099  Sphingosine biosynthesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    84431 (Asah1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    84431 (Asah1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    84431 (Asah1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    84431 (Asah1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    84431 (Asah1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.23  ceramidase
     84431 (Asah1)
Peptidases and inhibitors [BR:rno01002]
 Cysteine peptidases
  Family C89
   84431 (Asah1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   84431 (Asah1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CBAH NAAA-beta AAT HP_OMP
Motif
Other DBs
NCBI-GeneID: 84431
NCBI-ProteinID: NP_445859
RGD: 621568
Ensembl: ENSRNOG00000010034
UniProt: Q6P7S1
Position
16q12.1
AA seq 394 aa AA seqDB search
MLGRSLLTWVLAAAVTCAQAQQVPPWTEDCRKSTYPPSGPTYRGPVPWYTINLDLPPYKR
WHELLAHKAPVLRTLVNSISNLVNAFVPSGKIMQMVDEKLPGLIGSIPGPFGEEMRGIAD
VTGIPLGEIISFNIFYELFTMCTSIITEDGKGHLLHGRNMDFGIFLGWNINNNTWVVTEE
LKPLTVNLDFQRNNKTVFKATSFAGYVGMLTGFKPGLLSLTLNERFSLNGGYLGILEWMF
GKKNAQWVGFITRSVLENSTSYEEAKNILTKTKITAPAYFILGGNQSGEGCVITRERKES
LDVYELDPKHGRWYVVQTNYDRWKNTLFLDDRRTPAKKCLNHTTQKNLSFATIYDVLSTK
PVLNKLTVFTTLIDVTKDQFESHLRDCPDPCIGW
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgctgggccgtagtctcctcacctgggtcctggccgcggctgtcacctgcgcccaggca
cagcaagtgccaccgtggacagaagattgcagaaaatcaacttatcctccttctggacca
acctatagaggaccagttccgtggtacaccataaatcttgatttaccaccctacaagaga
tggcatgaattattggctcacaaggcacctgtgttgagaactttagtgaattccatctcg
aatttagtgaatgcatttgtgccaagtggaaaaataatgcagatggtggatgaaaagttg
cctggtctgattggcagcattcctggcccttttggagaggaaatgagggggattgcagat
gttactgggattcctctaggagagattatttcattcaacattttctatgaactgttcacc
atgtgtacatcgatcataactgaagatggaaaaggtcatttactacatggaagaaacatg
gattttggaatatttcttgggtggaacattaacaacaacacttgggtggtgacagaagaa
ttaaagcctttaacagtgaatttggacttccagaggaacaataagactgtgttcaaggct
acaagtttcgctggatacgtgggcatgttgacaggattcaaaccaggactgttaagtctt
acactgaatgaacgtttcagtttaaatggtggttatctgggtatcctagaatggatgttt
ggaaagaaaaatgcccaatgggtagggtttatcactagatcagttctggaaaatagcaca
agttatgaagaagccaagaatatattgaccaagaccaagataacggccccagcatatttt
atcctgggaggcaaccagtctggagaaggttgtgtgattacacgagaaagaaaagagtct
ttagacgtctatgaacttgatcctaagcatggcagatggtacgtggtacaaaccaattat
gaccggtggaaaaacaccttgtttcttgatgaccgcagaacacctgcgaagaagtgtcta
aatcacacgacacagaagaatctgtcatttgctaccatctatgatgttctatcaacaaaa
cctgtcctcaacaagctgactgtattcacaaccttgatagatgtcaccaaagatcaattt
gaaagccaccttcgagattgcccagacccttgtataggctggtga

DBGET integrated database retrieval system