KEGG   Rattus norvegicus (rat): 84471
Entry
84471             CDS       T01003                                 

Gene name
Snx1
Definition
(RefSeq) sorting nexin 1
  KO
K17917  sorting nexin-1/2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    84471 (Snx1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    84471 (Snx1)
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:rno04990]
    84471 (Snx1)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Macropinocytosis
   Sorting nexins
    84471 (Snx1)
Domain-containing proteins not elsewhere classified [BR:rno04990]
 Phox homology (PX) domain-containing proteins
  Sorting nexins
   84471 (Snx1)
SSDB
Motif
Pfam: Vps5 Sorting_nexin PX BAR_3_WASP_bdg Lipase_chap
Other DBs
NCBI-GeneID: 84471
NCBI-ProteinID: NP_445863
RGD: 68935
Ensembl: ENSRNOG00000017029
UniProt: Q99N27
Position
8q24
AA seq 522 aa
MASGGGGCSASERLPPPFPGMDPESEGAAGGSEPEAGDSDTEGEDIFTGAAAASKPQSPK
KTTSLFPIKNGSKENGIHEEQDQEPQDLFADATVELSLDSTQNNQKTMPGKTLIPHPTQE
ATNSPKPQPSYEELEEEEQEDQFDLTVGITDPEKIGDGMNAYVAYKVTTQTSLPMFRSRQ
FAVKRRFSDFLGLYEKLSEKHSQNGFIVPPPPEKSLIGMTKVKVGKEDSSSAEFLEKRRA
ALERYLQRIVNHPTMLQDPDVREFLEKEELPRAVGTQALSGAGLLKMFNKATDAVSKMTI
KMNESDIWFEEKLQEVECEEQRLRKLHAVVETLVNHRKELALNTALFAKSLAMLGSSEDN
TALSRALSQLAEVEEKIEQLHQEQANNDFFLLAELLSDYIRLLAIVRAAFDQRMKTWQRW
QDAQATLQKKRESEARLLWANKPDKLQQAKDEITEWESRVTQYERDFERISTVVRKEVTR
FEKEKSKDFKNHVIKYLETLLHSQQQLAKYWEAFLPEARAIS
NT seq 1569 nt   +upstreamnt  +downstreamnt
atggcgtcgggaggtggtggctgtagcgcttcggagcgactccctccgcccttccctgga
atggatccggagtccgaaggggctgccggggggtcagaacccgaggctggggacagcgac
accgagggggaggatattttcactggcgccgcggcagctagtaagccccagtctccaaag
aaaaccacatccctttttcctatcaaaaatggttccaaagaaaatgggatccatgaagaa
caagaccaagagccacaggacctctttgcagatgccacagtggaactatccctggacagc
acacagaataaccagaagacaatgccaggcaaaacacttattcctcatcctacgcaagaa
gccacaaattctcctaagccacagccaagctatgaagagctggaggaagaagaacaggag
gatcagtttgatttgacagttggtatcactgatcctgagaagatcggggacggtatgaat
gcctatgtagcctacaaagtcaccacacagacaagcttaccgatgttcagaagtaggcag
tttgcagtgaaaagaagattcagtgactttctgggtctttatgagaagctctcagagaag
cactcccagaatggtttcattgtccctcctccacctgagaagagcctaataggaatgaca
aaggtgaaggttgggaaggaagattcttcttctgcagagtttcttgagaaacggagggct
gctttggaaaggtaccttcaaagaattgtgaatcatcctaccatgttacaggacccagat
gtcagggagtttttagaaaaagaagagctgcctcgagctgtaggtacgcaggctctaagt
ggtgctggtctccttaagatgttcaacaaagctacagatgcagtcagcaaaatgaccatc
aagatgaatgaatcagacatttggttcgaggagaagctccaggaggtggagtgtgaggaa
cagcgcctacggaagctgcacgctgtggtggagactctagtcaaccataggaaagaacta
gcactgaatacagccctgtttgccaagagtctagccatgcttggcagctccgaggacaac
acagcactgtctcgagcactctcccaactggctgaggtggaagaaaagattgagcagctc
caccaggaacaggccaacaatgacttcttcctcctggctgaactcctgagtgactatatc
cgcctcctggccattgtccgagccgccttcgaccagcgcatgaagacatggcagcgctgg
caggatgctcaagccacgctgcagaagaagcgggagtctgaggctcggctgctgtgggcc
aacaagcctgacaaactgcagcaggctaaggatgagattacagagtgggaatctcgggtg
actcagtatgaaagggactttgaaaggatttcaacagttgtccgaaaggaggtgacacga
tttgagaaagagaaatccaaggacttcaaaaaccacgtgatcaagtacctggagacactc
ctgcattcccagcagcagctggcaaaatactgggaagccttccttcctgaggccagggcc
atctcctga

DBGET integrated database retrieval system