KEGG   Rattus norvegicus (rat): 84475Help
Entry
84475             CDS       T01003                                 

Gene name
Cxcr3, Gpr9
Definition
(RefSeq) C-X-C motif chemokine receptor 3
  KO
K04188  C-X-C chemokine receptor type 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    84475 (Cxcr3)
   04061 Viral protein interaction with cytokine and cytokine receptor
    84475 (Cxcr3)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    84475 (Cxcr3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    84475 (Cxcr3)
   04050 Cytokine receptors [BR:rno04050]
    84475 (Cxcr3)
   04090 CD molecules [BR:rno04090]
    84475 (Cxcr3)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Chemokine
   CXC Chemokine
    84475 (Cxcr3)
Cytokine receptors [BR:rno04050]
 Chemokine receptors
  CXC Chemokine
   84475 (Cxcr3)
CD molecules [BR:rno04090]
 Proteins
  84475 (Cxcr3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 Ctr
Motif
Other DBs
NCBI-GeneID: 84475
NCBI-ProteinID: NP_445867
RGD: 621528
Ensembl: ENSRNOG00000003305
Vega: OTTRNOG00000000648
UniProt: Q9JII9
Position
Xq22
AA seq 367 aa AA seqDB search
MYLEVSERQVLDASDIAFLLENSTSPYDYGENESDFSDSPPCPQDFSLNFDRTFLPVLYS
LLFLLGLLGNGAVAAVLLSQRTALSSTDTFLLHLAVADVLLVLTLPLWAVDAAAQWVFGS
GLCKVAGALFNINFYAGAFLLACISFDRYLSIVHATQIYRRDPWVRVALTCIVVWGLCVL
FALPDFIFLSASHDQRLNATHCQYNFPQVGRTALRVLQLVAGFLMPLLVMAYCYAHILAV
LLVSRGQRRFRAMRLVVVVVVAFAVCWTPYHLVVLVDILMDVGVLARNCGRESHVDVAKS
VTSGMGYMHCCLNPLLYAFVGVKFKEQMWMLLMRLGRSDQRGPQRQPSSSRRESSWSETT
EASYLGL
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgtaccttgaggtcagtgaacgtcaagtgctagatgcctcggacattgcctttcttctg
gaaaacagcacatctccctacgattatggggaaaacgaaagcgacttctctgactccccg
ccctgcccacaggacttcagcctgaactttgacagaaccttcctgccagtcctctacagc
ctcctctttttgctggggctgctaggcaatggggcagtggctgctgtgctactgagccag
cgcactgccctgagcagcacagacaccttcctgctccacctggctgtggccgatgtactg
ctggtactaaccctcccactgtgggcagtagatgctgctgcccagtgggttttcggctct
ggtctctgcaaagtggcaggtgccctgttcaacatcaacttctacgcaggggccttcctg
ctggcctgtataagctttgaccgctacctgagcatagtgcatgccacccagatctaccgc
agggacccctgggtacgtgtagccctcacctgcattgttgtgtggggtctctgtgtgctc
tttgccctcccagatttcatcttcctgtcagccagccatgatcagcgcctcaatgccacc
cattgccagtacaacttcccacaggtgggtcggactgctctgcgtgtactgcagctagtg
gctggtttcctgatgccccttctagtcatggcctactgctatgcccatatcctggctgtg
ctgctggtctccagaggccagaggcgctttcgagctatgaggctagtggtggtggtggtg
gtggcctttgccgtctgctggaccccctatcacctggtggtgttagtggatatccttatg
gacgtgggagttttggcccgcaactgtggtcgagaaagccatgtggacgtagccaagtca
gtcacctcaggcatgggctacatgcactgctgcctcaatccactgctctatgcctttgtg
ggagtgaagttcaaagaacaaatgtggatgttgctcatgcgcctgggccgctctgaccag
agaggaccgcagcggcagccttcatcttcacggagagaatcatcctggtctgagacaact
gaggcctcctacttgggcttgtaa

DBGET integrated database retrieval system