KEGG   Rattus norvegicus (rat): 84476Help
Entry
84476             CDS       T01003                                 

Gene name
Strbp, Spnr
Definition
(RefSeq) spermatid perinuclear RNA binding protein
  KO
K13200  spermatid perinuclear RNA-binding protein
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:rno03041]
    84476 (Strbp)
Spliceosome [BR:rno03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA binding proteins (RBPs)
    84476 (Strbp)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DZF dsrm SGP
Motif
Other DBs
NCBI-GeneID: 84476
NCBI-ProteinID: NP_445868
RGD: 620673
Ensembl: ENSRNOG00000010150
UniProt: D3ZDD7
Position
3q11
AA seq 672 aa AA seqDB search
MRSIRSFANDDRHVMVKHSTIYPSPEELEAVQNMVSTVECALKHVSDWLDETNKGTKPEG
ETEVKKDDAVENYSKDQGGRTLCGVMRIGLVAKGLLIKDDMDLELVLMCKDKPTETLLNT
VKDNLPIQIQKLTEEKYQVEQCINEASIIIRNTKEPTLTLKVILTSPLIRDELEKKDGEN
VMMKDPPDLLDRQKCLNALASLRHAKWFQARANGLKSCVIVLRILRDLCNRVPTWAPLKG
WPLELICEKSIGTCNRPLGAGEALRRVMECLASGILLPGGPGLHDPCERDPTDALSYMTT
QQKEDITHSAQHALRLSAFGQIYKVLEMDPLPSSKPFQKYSWSVTDKEGAGSSALKRPFE
DGLGDDKDPNKKMKRNLRKILDSKAIDLMNALMRLNQIRPGLQYKLLSQSGPVHAPVFTM
SVDVDGTTYEASGPSKKTAKLHVAVKVLQAMGYPTGFDADIECMSSDEKSDNESKNDTVS
SNSSNNTGNCTTETSSTLEVRTQGPILTASGKNPVMELNEKRRGLKYELISETGGSHDKR
FVMEVEVDGQKFRGAGPNKKVAKASAALAALEKLFSGPNAANNKKKKIIPQAKGVVNTAV
SAAVQAVRGRGRGTLTRGAFVGATAAPGYIAPGYGTPYGYSTAAPAYGLPKRMVLLPVMK
FPTYPVPHYSFF
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atgagatctattagatcttttgccaatgatgatcgccatgttatggtgaaacattcaaca
atctatccttctccagaggaacttgaagctgtgcaaaatatggtgtctactgttgaatgt
gctcttaaacatgtctcagattggctggacgaaacaaacaaaggcacaaaacctgagggg
gagacagaagtaaagaaagatgacgctgtggaaaactattccaaggatcaaggtggccgg
acattgtgtggtgtaatgaggattggcttggttgcaaaaggcttgctgattaaagatgac
atggacctggagctggtcttaatgtgtaaagacaaacccacagaaactctgctaaataca
gtgaaagataaccttcctattcaaattcagaaactaacagaagagaaataccaagtggaa
caatgtataaatgaagcgtccattataattcggaacacgaaagagccaacactgactttg
aaggtgatacttacttcccctctaattagggacgaattggagaagaaggatggagaaaat
gttatgatgaaagaccctccggacttattggacaggcagaaatgcctgaatgccttggct
tctcttcgacatgccaaatggtttcaggcaagggcaaatggattaaaatcatgtgtaatt
gtcctccgcattctgcgtgatttgtgcaacagagtacccacatgggcaccattgaaagga
tggccactagagcttatatgtgaaaagtctataggtacttgtaatagacctttgggcgct
ggggaggccttgagacgagtaatggagtgtttggcatctggaatactacttcctggtggt
cctggtcttcatgatccttgtgagcgagacccaaccgatgctctaagctacatgaccact
cagcaaaaagaagatatcacccatagtgcacagcatgcacttagactatcagcctttggc
cagatttataaagtactggagatggaccctcttccatctagtaagccttttcagaagtat
tcctggtcagttactgataaagaaggtgccgggtcttcagctctaaagaggccatttgaa
gatggattaggggatgataaagatcccaacaagaagatgaaacgaaacttaaggaaaatt
ctggatagtaaagcaatagaccttatgaatgcactaatgagattaaatcagatcaggcct
gggcttcagtataagcttttgtcgcagtctggcccggtccatgccccagtcttcacaatg
tcggtagatgtggacggcacaacatacgaagcctcaggaccatccaagaaaacagcaaag
cttcatgtggcagtgaaggttttacaggcaatgggatacccaacaggttttgatgcagat
attgaatgtatgagttccgatgaaaaatcagataatgaaagcaaaaatgatacagtatct
tcaaactcaagcaataatactggaaattgtacaactgagacctccagtaccttagaggta
agaactcagggtcctatcctcacagcaagtggcaaaaatcctgtgatggagctcaatgaa
aaaagaagaggtctcaagtatgaactcatctcagaaactggtggaagccatgacaagcgc
tttgtaatggaggtagaagtagatggacagaaattcagaggtgcaggtccaaacaagaaa
gtggccaaggcaagtgcagcgctagctgccctggaaaagctgttttctggacccaatgca
gcaaataataagaaaaagaagatcattcctcaggcaaagggtgttgtgaatacggcagta
tctgcagcagtccaggcagttcgaggcagaggaagaggaactctgacaaggggagcgttc
gtgggagctacagcagctcctggatatatagctccaggttatggaactccatatggttac
agcacagctgcccctgcatatggtttgcccaagagaatggttctgttacccgttatgaaa
ttcccaacatatcctgttccccactactcattcttttag

DBGET integrated database retrieval system