KEGG   Rattus norvegicus (rat): 84477
Entry
84477             CDS       T01003                                 

Gene name
Gab2
Definition
(RefSeq) GRB2-associated-binding protein 2
  KO
K08091  GRB2-associated-binding protein 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04014  Ras signaling pathway
rno04071  Sphingolipid signaling pathway
rno04072  Phospholipase D signaling pathway
rno04380  Osteoclast differentiation
rno04664  Fc epsilon RI signaling pathway
rno04666  Fc gamma R-mediated phagocytosis
rno05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    84477 (Gab2)
   04072 Phospholipase D signaling pathway
    84477 (Gab2)
   04071 Sphingolipid signaling pathway
    84477 (Gab2)
 09150 Organismal Systems
  09151 Immune system
   04664 Fc epsilon RI signaling pathway
    84477 (Gab2)
   04666 Fc gamma R-mediated phagocytosis
    84477 (Gab2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    84477 (Gab2)
 09160 Human Diseases
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    84477 (Gab2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:rno04990]
    84477 (Gab2)
Domain-containing proteins not elsewhere classified [BR:rno04990]
 Pleckstrin homology (PH) domain-containing proteins
  Grb-2 associated binder (Gab) family proteins
   84477 (Gab2)
SSDB
Motif
Pfam: PH PH_11 PH_2 PH_3 PH_9 PH_8
Other DBs
NCBI-GeneID: 84477
NCBI-ProteinID: NP_445869
RGD: 621367
Ensembl: ENSRNOG00000011882
UniProt: Q9EQH1
Position
1
AA seq 664 aa
MSGGGDDVVCTGWLRKSPPEKKLRRYAWKKRWFILRSGRMSGDPDVLEYYKNEHSKKPLR
IINLNFCEQVDAGLTFNKKELQDSFVFDIKTSERTFYLVAETEADMNKWVQSICQICGFN
QAEESTDSLRNLSSASHGPRSSPAEFSSSQHLLRERKSSAPSHSSQPTLFTFEPPMSSHM
QPALSTSAPQEYLYLHQCISRRTENSRSASFSQGTRQKSDTAVQKLAQSNGHCINGVSNQ
VHGFYSLPKPSRHNTEFKDSTYDLPRSLASHGHTKSSLTGSETDNEDVYTFKMPSNTLCR
EFGDLLVDNMDVPTTPLSAYQIPRTFTLDKNHNAMTVATSGDSAIAPPPRPPKPSQAETP
RWGSPQQKPPIGENSRSVAATIPRRNTLPAMDNSRLHRASSCETYEYPTRGSGESASWSA
ESPGKTAVGRSNSASSDDNYVPMNPGSSTLLAMERAGDNSQSAYIPMSPGPHHFDPLGYP
STALPIHRGPSRGSEIQPPPVNRNLKPDRKAKPTPLDLRNNTVIDELPFKSPVTKSWSRI
NHTFNSSSSQYCRPISTQSITSTDSGDSEENYVPMQNPVSASPVPSGTNSPAPRKSTGSV
DYLALDFQPGSPSPHRKPSTSSVTSDEKVDYVQVDKEKTQALQNTMQEWTDVRQSSEPSK
GAKL
NT seq 1995 nt   +upstreamnt  +downstreamnt
atgagcggcggcggcgacgacgtggtgtgtaccggctggctgaggaaatcgcctccggaa
aagaagttgaggcgctatgcctggaagaaacgctggtttatactgcggagtggccggatg
agtggagacccagatgttctggaatactacaagaacgagcactccaagaaacccctgcgg
atcatcaacctgaacttctgtgagcaggtggatgcaggcctgaccttcaacaagaaagag
ctacaggatagctttgtgtttgatatcaagaccagcgagcgcacgttttacctggtggct
gagacggaggctgacatgaacaagtgggtccagagcatctgccagatttgcggtttcaat
caagccgaagagagcacagactccctgagaaacctttcttcagccagtcacggtccccgc
tcctctccagctgagttcagctccagtcagcacctgctccgagaacggaagtcctcagcc
ccttcacactctagccagcccactttattcacatttgagccccctatgtcaagccacatg
cagcctgccttgtccaccagtgcacctcaggagtatctctacttgcaccagtgcataagc
agaaggacagaaaactcaaggagtgccagcttctctcagggcacccggcagaagagtgat
acagccgtgcaaaaacttgcccagagcaatggacactgtatcaatggagtcagcaatcaa
gtccatggtttctatagccttcccaagccaagccgacacaatacagaattcaaagacagt
acttatgatctcccgaggagcctggcgtcacatggccacaccaagagcagcctcacaggg
tctgagactgataacgaggatgtgtataccttcaagatgcccagcaacaccctgtgtcgg
gagtttggagacctccttgtggacaatatggatgttccaaccacccctctctcagcctac
cagatccctagaacatttacactggacaagaatcacaatgccatgacagtggccacttct
ggagactcagccatagctcccccaccccggccacccaagccaagtcaagcagaaacacct
cgatggggcagccctcagcaaaaacctccgatcggcgagaatagcagatctgtagctgct
actatccccaggcgcaataccctccctgcaatggacaacagccggctccaccgagcttcc
tcctgtgagacctatgaatacccaacacgaggcagcggagagagtgccagctggtctgct
gaatctccaggaaagactgccgtgggtcgatcaaacagtgccagctctgatgacaactac
gtgcccatgaacccaggttcttctaccctgctggccatggaacgagccggggacaattcc
cagagtgcctacatacccatgagcccagggcctcatcactttgatccacttgggtaccca
tccacagcccttcctattcacagaggccccagccgaggaagtgagatccagccaccccca
gtcaaccgaaacctcaaacctgaccgaaaagcaaagccaacaccccttgacctgagaaac
aacactgtcatcgatgagctccccttcaagtcacctgtcaccaagtcttggtccaggatc
aaccacacctttaactccagttcctcccagtactgccgtcctatctccacacagagcatc
accagcacagactcaggagacagtgaggagaactatgtccctatgcaaaacccagtatct
gcgtcccctgttcccagtggcactaacagcccagctcccaggaagagtactggcagtgtg
gattacctagccctggacttccagccgggctccccaagccctcaccgcaagccatccaca
tcatctgtcacatcggatgagaaggtagactatgtccaagtggataaagagaagacacag
gccctgcagaacaccatgcaggagtggacagatgtacggcagtcctcagaaccttccaag
ggtgccaagctgtga

DBGET integrated database retrieval system