KEGG   Rattus norvegicus (rat): 84479Help
Entry
84479             CDS       T01003                                 

Gene name
Synrg, Ap1gbp1, Syng
Definition
(RefSeq) synergin, gamma
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_4
Motif
Other DBs
NCBI-GeneID: 84479
NCBI-ProteinID: NP_445871
RGD: 620684
UniProt: Q9JKC9
Position
10q26
AA seq 1329 aa AA seqDB search
MALRPGAGASGAAGAGTGPGGAGSFMFPVAGGMRPPQGLIPMQQQGFPMVSVMQPNMQGM
MGMNYSSQMSQGPIAMQAGIPMGPMPAAGVPFLGQPPFLGMRPAAPQYTPDMQKQFAEEQ
QKRFEQQQKLLEEERKRRQFEEQKQKLRLLSSVKPKTGEKNRDDALEAIKGNLDGFSRDA
KMHPTPASHPKKPDCPTSSHSTKTVSPSSAFLGEDEFSGFMQGPVELPTCGPSSTAQPFQ
SFLPSTPLGQLHTQKAGAQPLPPGQAPVSFAVHGVHGQIPCLSAASASHSMQKAGPSLEE
KLLVSCDISASGQEHIKLSSPEAGHRAVVPGSSKNSPGLMAHNGGAVDGCVSGPTTAVAE
KTSDQNLSKEESGVGVFPSQDPVQPRMPPWIYNESLVPDAYKKILETTMTPTGIDTAKLY
PILMSSGLPRETLGQIWALANRTTPGKLTKEELYTVLAMVAVTQRGVPAMSPDTLNQFPA
APIPTLSGFPMTLPTPVSQPTAMTSGPAGSIPLSLGQPIMGINLVGPVGGAAAPTSSGFM
PAYPSNQVGKTEEDDFQDFQDASKSGSIDDSFTDFQEVPASSKTSNSQHGNSAPSLLIPL
PGTKASTDKYAVFKGISAEKPSENPASFGESGDKYSAFRELEPTADSKPLGESFAEFRST
GTDDGFTDFKTADSVSPLEPPTKDSFPSAFASGAAQQTQTQVKTPLNLADLDMFSSVDCS
GEKPVPFSAAFSTSKSVSSRPQPAGSAAAPASLASTKASSLADDFGEFNLFGEYSNPASV
GEQDDFADFMAFGNSSIPSEPKADDKYEALREEGSPGALSTSTVEGAHNPPVSSSKYDVF
KQLSLEGAGLAIEEFKENTPSTKSDGDFADFHSSKFSSTSSDKSLGEKAVAFRHAKEDSA
SVKSLDLPSIGGSSVGKEDSEDALSVQFDMKLADVGGDLKHVMSDSSLDLPTVSGQHPPA
AGSALASEDALPETPFPAFASFKDMMPQTTEQKEYESGDFQDFTRQDMPMVDRSQENTCP
SPASSVASHETPKEGADDFGEFQSEKPKISKFDFLVANSQSKMKSSEEMIKSELATFDLS
VQGSHKRSLSLGDKEISRSSPSPALEQPFRDRSNTLSERAALPVIRDKYKDLTGEVEENE
RYAYEWQRCLGSALDVIKKANDTLNGISSSAVCTEVIQSAQGMEYLLGVVEVYRVTKRVE
LGIKATAVCSEKLQQLLKDIDKVWNNLIGFMSLTTLTPDENSLDFSSCMLRPGIKNAQEL
ACGVCLLNVDSRSRKEETPAEEQPKKAFNSETDSFKLAYGGHQYHASCANFWINCVEPKP
PGLLLPDLL
NT seq 3990 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgcggccgggagccggagccagcggcgcggcgggggcgggcacagggcccggc
ggggcaggcagcttcatgtttcctgtcgcaggtggcatgagaccccctcaaggcctgatt
ccaatgcagcagcaaggatttcctatggtctctgtcatgcagcccaatatgcaaggcatg
atgggaatgaattacagctctcagatgtcccagggacccattgcaatgcaggcaggaata
ccaatggggccaatgccagcagcgggtgtacctttcctgggtcagccaccttttctgggc
atgcgtcctgcagccccacagtacactccagacatgcagaagcagtttgcggaagagcaa
caaaaacgatttgaacaacaacaaaagctcttagaagaagaaagaaaacgacgtcagttt
gaagagcaaaaacaaaagctcagacttctgagtagcgtgaaacccaagacaggagagaag
aacagagacgacgctttggaagccatcaaaggaaacttggatgggttttccagagatgct
aagatgcaccccactcccgcatctcacccaaagaaaccagactgccccacatcatctcat
tctactaaaactgtctccccgtcatctgcctttcttggtgaagatgaattcagtggcttt
atgcaggggcctgttgagcttcccacttgtgggccttcttccacagcccagccctttcag
tctttcctccccagcaccccactcggccagttacacacacagaaggctggggcacagcct
ctacctccaggtcaggctccagtgtcttttgccgtacatggtgtccatgggcaaattcct
tgtttatctgctgcttcagcttcccacagtatgcagaaagcaggcccttccttggaagag
aagctcctagtatcttgtgatataagtgcatctgggcaggaacacattaaattaagctct
cctgaagctgggcacagagccgtagtcccaggttccagtaagaactctcccggtttaatg
gcccataacgggggtgctgtagatggatgtgtgagtggtcccaccactgcagtcgcagaa
aagacttcagatcaaaacctgtcaaaggaagagagtggtgtgggcgtgtttccctctcag
gatcctgttcagcccagaatgcctccttggatttacaatgagagtttggttccagatgct
tataagaaaattttagaaaccacaatgactccaaccggaatagacactgctaaactttat
cccattctgatgtcatctggacttcccagggaaactcttggacagatatgggccttagct
aatcgaactacgcctggcaagctcactaaggaggagctttacaccgttctcgccatggta
gcagtaacacagagaggtgttcctgccatgagccctgatactttgaaccagttccctgcg
gctcccattcctaccttaagcggctttcctatgactctgcctaccccagtgagccagcca
acagcgatgacctctggccccgcaggctccatacccctcagccttggacagcccatcatg
ggcattaaccttgttggaccagtgggtggagctgcagcgccaacttccagtggcttcatg
ccagcctacccctcaaaccaggtgggaaagacagaagaagatgacttccaggattttcaa
gatgcttcgaagtcaggatccatcgatgattctttcactgacttccaagaggtgcctgcg
tcctcaaaaaccagtaattcccagcatggaaacagtgctccctcactcttgatcccactt
cctggaactaaagcctccacagacaaatatgcagtgtttaaagggatttctgctgagaag
ccctctgaaaaccctgcttcatttggagagtccggtgataaatacagtgctttcagggaa
ctcgagccaacagcagacagtaagcctttaggagagagctttgcggagttcagatccaca
ggaaccgatgatggcttcactgacttcaagactgctgatagtgtgtcacccctagagcca
ccaacaaaagactcttttccatcggcctttgcctcaggagctgcacagcagacacagaca
caggtgaaaacccctctgaacttagcagacctagatatgttctcctcagtggattgcagt
ggggagaaaccagtgcccttttcagctgcatttagcacctcaaagtcagtttcctcaaga
cctcagccggcgggttctgcagcagccccagcatcactggcatccactaaagcgtccagt
ttggcagatgattttggagagttcaacctctttggggaatattcgaaccctgcgtctgtt
ggggagcaggacgactttgcagatttcatggctttcggtaacagctccatcccctctgag
ccaaaagcagatgacaagtatgaagccctcagagaagaagggagccccggcgccttgtcc
accagcactgtggagggtgcacacaacccacctgtttcgtcatccaagtacgacgtcttc
aaacagctttccctagagggagctggactggccatcgaggagttcaaagagaacactcct
tccacaaaaagtgacggtgactttgctgacttccactccagtaaattctcatccacgagc
tcagacaaatccctgggagagaaagcagtggctttcagacatgccaaagaagactccgcc
tcggtgaagtctttagacctcccctccatcggtggcagcagtgttggcaaggaggactct
gaagatgcgctttctgttcagtttgacatgaagttggctgatgtaggaggagatcttaag
catgtcatgtctgatagctctttggatttaccaacagttagtggccaacatcctcctgcc
gcaggatcagccttggccagtgaggacgctcttccagagactcccttcccagcttttgcc
agctttaaagacatgatgccccagaccactgagcagaaagagtatgaaagtggggacttc
caggatttcacaaggcaggacatgcccatggtggaccggagccaagagaacacatgtccc
agcccagcttccagtgtggcctcgcacgaaacccccaaggagggtgcagacgactttgga
gaatttcaaagtgaaaagcccaaaatcagcaagtttgactttttagtagctaattcacag
agcaaaatgaagtctagtgaagaaatgatcaaaagtgagctggcaacctttgacctttct
gttcaaggatcacacaagaggagcttgagccttggggataaagaaataagcaggtcctct
ccttccccggccctggagcagcccttcagagaccggtccaacactctgagtgagagagct
gcactgcccgtcatccgagacaagtacaaggatctgactggcgaagtggaggaaaatgag
agatacgcgtatgagtggcagagatgcctggggagcgccctggatgtcattaagaaggca
aacgacaccttaaacggcattagcagcagtgctgtctgcacagaagttatccagtcagcc
caaggcatggagtatctcctaggcgtggtggaagtgtaccgagtaaccaagcgcgtggag
ctggggatcaaagccactgctgtgtgtagtgagaaactccagcagttgctgaaggacatc
gataaagtgtggaacaacttaatcggcttcatgtcacttaccacactcacgccagatgag
aattcactggatttttcctcctgtatgttacggcctgggatcaaaaacgcccaggagctg
gcttgtggagtgtgtctcctaaatgtggactccagaagccggaaagaagagacacctgca
gaagaacagcctaaaaaagcattcaactcagaaacagacagtttcaagctggcctatggg
ggacatcagtaccacgccagctgtgccaacttctggatcaactgtgttgaacccaagcct
cccggcctcctcttgccagatctgctctga

DBGET integrated database retrieval system