KEGG   Rattus norvegicus (rat): 84480Help
Entry
84480             CDS       T01003                                 

Gene name
Bnip3
Definition
(RefSeq) BCL2/adenovirus E1B interacting protein 3
  KO
K15464  BCL2/adenovirus E1B 19 kDa protein-interacting protein 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04068  FoxO signaling pathway
rno04137  Mitophagy - animal
rno04140  Autophagy - animal
rno05134  Legionellosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    84480 (Bnip3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    84480 (Bnip3)
   04137 Mitophagy - animal
    84480 (Bnip3)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    84480 (Bnip3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    84480 (Bnip3)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    84480 (Bnip3)
Membrane trafficking [BR:rno04131]
 Autophagy
  Mitophagy
   Cargo receptors
    84480 (Bnip3)
Transporters [BR:rno02000]
 Other transporters
  Pores ion channels [TC:1]
   84480 (Bnip3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BNIP3 DUF4692
Motif
Other DBs
NCBI-GeneID: 84480
NCBI-ProteinID: NP_445872
RGD: 620800
Ensembl: ENSRNOG00000017243
UniProt: Q9ET45
Position
1q41
AA seq 187 aa AA seqDB search
MSQSGEENLQGSWVELHFSNGNGSSVPASVSIYNGDMEKILLDAQHESGRSSSKSSHCDS
PPRSQTPQDTNRAEIDTHSFGEKNSTLSEEDYIERRREVESILKKNSDWIWDWSSRPENV
PPKEFLFKHPKRTATLSMRNTSVMKKGGIFSADFLKVFLPSLLLSHLLAIGLGIYIGRRL
TTSTSTF
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcagagcggggaggagaacctgcagggctcctgggtagaactgcacttcagcaat
gggaatgggagcagcgttccagcttccgtctctatttataatggtgacatggaaaaaata
ctgctggatgcgcagcatgaatctggacgaagcagctccaagagctctcactgtgacagc
ccacctcgctcccagacaccacaagataccaacagagctgaaatagacacccacagcttt
ggtgagaaaaacagcactctgtctgaggaagattatattgagagaagaagagaagttgaa
agtatcctgaagaaaaactcagattggatatgggattggtcaagtcggccagaaaatgtt
ccccccaaggagttcctttttaaacacccgaagcgcacagctactctcagcatgagaaac
acaagcgttatgaagaaagggggtattttctcagcagactttctgaaggttttccttcca
tctctgttactgtctcatctgttagccattggattggggatctacattggaaggcgtctg
acaacttccactagtaccttttga

DBGET integrated database retrieval system