KEGG   Rattus norvegicus (rat): 84482Help
Entry
84482             CDS       T01003                                 

Gene name
Foxo1, Fkhr, Foxo1a
Definition
(RefSeq) forkhead box O1
  KO
K07201  forkhead box protein O1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04068  FoxO signaling pathway
rno04152  AMPK signaling pathway
rno04211  Longevity regulating pathway
rno04213  Longevity regulating pathway - multiple species
rno04218  Cellular senescence
rno04910  Insulin signaling pathway
rno04919  Thyroid hormone signaling pathway
rno04922  Glucagon signaling pathway
rno04931  Insulin resistance
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno05165  Human papillomavirus infection
rno05200  Pathways in cancer
rno05202  Transcriptional misregulation in cancer
rno05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    84482 (Foxo1)
   04152 AMPK signaling pathway
    84482 (Foxo1)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    84482 (Foxo1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    84482 (Foxo1)
   04922 Glucagon signaling pathway
    84482 (Foxo1)
   04919 Thyroid hormone signaling pathway
    84482 (Foxo1)
  09149 Aging
   04211 Longevity regulating pathway
    84482 (Foxo1)
   04213 Longevity regulating pathway - multiple species
    84482 (Foxo1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    84482 (Foxo1)
   05202 Transcriptional misregulation in cancer
    84482 (Foxo1)
  09162 Cancer: specific types
   05215 Prostate cancer
    84482 (Foxo1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    84482 (Foxo1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    84482 (Foxo1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    84482 (Foxo1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    84482 (Foxo1)
Transcription factors [BR:rno03000]
 Eukaryotic Type
  Helix-turn-helix
   Fork head/winged helix other regulators
    84482 (Foxo1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FOXO_KIX_bdg Forkhead FOXO-TAD
Motif
Other DBs
NCBI-GeneID: 84482
NCBI-ProteinID: NP_001178775
RGD: 620283
Ensembl: ENSRNOG00000013397
UniProt: G3V7R4
Position
2q26
AA seq 649 aa AA seqDB search
MAEAPQVVETDPDFEPLPRQRSCTWPLPRPEFNQSNSTTSSPAPSGSTAANPDATASLAS
ASAVSTDFMSNLSLLEESEDFARAPGCVAVAAAAAASRGLCGDFQGPEAGCVHSAPPQPP
PTGPLSQPPPVPPAAAGPLAGQPRKTSSSRRNAWGNLSYADLITKAIESSAEKRLTLSQI
YEWMVKSVPYFKDKGDSNSSAGWKNSIRHNLSLHSKFIRVQNEGTGKSSWWMLNPEGGKS
GKSPRRRAASMDNNSKFAKSRGRAAKKKASLQSGQEGPGDSPGSQFSKWPASPGSHSNDD
FDNWSTFRPRTSSNASTISGRLSPIMTEQDDLGDGDVHSLVYPPSAAKMASTLPSLSEIS
NPENMENLLDNLNLLSSPTSLTVSTQSSPGSMMQQTPCYSFAPPNTSLNSPSPNYAKYTY
GQSSMSPVPQMPMQTLQDSKSSYGGLNQYNCAPGLLKELLTSDSPPHNDIMSPVDPGVAQ
PNSRVLGQNVLMGPNSVMPAYGSQAPHNKMMNPSSHTHPGHAQQTSSVNGRALPHVVNTM
PHTSAMNRLTPVKTPLQVPLSHPMQMSALGNYSSVSSCNGYGRMGVLHQEKLPSDLDGMF
IERLDCDMESIIRNDLMDGDTLDFNFDNVLPNQSFPHSVKTTTHSWVSG
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atggccgaagcgcctcaggtggtggagaccgacccggacttcgagccgctgcctcggcag
cgctcctgcacctggccgctgcccaggccggagtttaaccagtccaactcgaccacctcc
agcccggcgccgtcgggcagcacggccgccaaccccgacgccacggcgagcctggcctcg
gcgtccgctgtcagcaccgactttatgagcaacctgagcctgctagaagagagcgaggac
ttcgcgcgggcaccgggttgcgtggccgtggcggccgcagctgccgccagtaggggcctg
tgcggggacttccagggcccggaggcgggctgcgtgcactcggcgccgccgcagccccca
ccgaccgggccgctgtcgcagcccccaccggtgcctccagccgccgcggggccactcgct
gggcagccgcgcaagaccagttcgtcgcgccgcaacgcgtggggcaacctgtcgtacgcc
gacctcatcaccaaggccatcgagagctcggcggagaagaggctcaccctgtcgcagatc
tacgagtggatggtgaagagtgtgccctacttcaaggataagggcgacagcaacagctcg
gcgggctggaagaattcaattcgccacaatctgtccctacacagcaagtttattcgagta
cagaatgaaggaactgggaaaagttcttggtggatgctcaatccagagggaggcaagagt
gggaaatcaccccggagaagagctgcatccatggacaacaacagtaaatttgctaagagc
cgaggacgggctgctaagaaaaaagcatctctccagtccgggcaagagggtcctggagat
agccctgggtctcagttttctaaatggcctgcaagccctgggtcccacagcaatgatgac
tttgataactggagtacatttcgtcctcgaaccagctcaaacgctagcaccatcagtggg
agactttctcccatcatgacagagcaggatgacctgggggatggggatgtgcattccctg
gtgtatccaccctctgctgccaagatggcgtctacactgcccagtctgtctgaaatcagc
aatccagaaaacatggagaaccttctggataatctcaatcttctctcatccccaacatct
ttaactgtgtcaacccagtcctcgcctggcagcatgatgcagcagacaccttgctattca
tttgcaccgccaaacaccagtctaaattcccccagccccaactacgcaaagtacacgtac
ggccaatccagcatgagccctgtgccccagatgcctatgcagacacttcaggacagcaaa
tcaagttatggaggattgaaccagtataactgtgccccaggactcttgaaagagttgctg
acttctgactctcctccccacaatgatattatgtcaccagtcgatcctggagtggctcaa
cccaacagtcgggtcctgggccaaaatgtactgatgggccctaactcagtcatgccagcc
tatggcagccaggcacctcataacaaaatgatgaaccccagttcccacacccaccctgga
catgcacagcaaacttcttcagtcaatggccgtgccctgccccatgtggtgaacaccatg
cctcacacatctgccatgaaccgcttgaccccagtgaagacacctttacaagtgcctctg
tcccaccccatgcagatgagtgccctgggcaactactcctctgtgagcagctgcaatggc
tatggtaggatgggtgtcctccaccaggagaagctcccaagtgacttggatggcatgttt
attgagcgcttggactgtgacatggagtccatcattcggaacgacctcatggacggagat
accttggattttaactttgataatgtgttgcccaaccaaagcttcccgcacagtgtcaag
actacaacacacagctgggtgtcaggctag

DBGET integrated database retrieval system