KEGG   Rattus norvegicus (rat): 84484Help
Entry
84484             CDS       T01003                                 

Gene name
Slc4a4, HHNMC, HNBC1, KNBC, NBC2, Nbc1, Nbc4, PNBC, SLC4A5
Definition
(RefSeq) solute carrier family 4 member 4
  KO
K13575  solute carrier family 4 (sodium bicarbonate cotransporter), member 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04964  Proximal tubule bicarbonate reclamation
rno04972  Pancreatic secretion
rno04976  Bile secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    84484 (Slc4a4)
   04976 Bile secretion
    84484 (Slc4a4)
  09155 Excretory system
   04964 Proximal tubule bicarbonate reclamation
    84484 (Slc4a4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    84484 (Slc4a4)
Transporters [BR:rno02000]
 Solute Carrier Family (SLC)
  SLC4: Bicarbonate transporter
   84484 (Slc4a4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HCO3_cotransp Band_3_cyto PTS_EIIA_2 Fmp27_WPPW
Motif
Other DBs
NCBI-GeneID: 84484
NCBI-ProteinID: NP_445876
RGD: 68936
Ensembl: ENSRNOG00000003134
UniProt: Q9JI66
Position
14p22
AA seq 1079 aa AA seqDB search
MEDEAVLDRGASFLKHVCDEEEVEGHHTIYIGVHVPKSYRRRRRHKRKAGHKEKKEKERI
SENYSDKSDVENADESSSSILKPLISPAAERIRFILGEEDDSPAPPQLFTELDELLAVDG
QEMEWKETARWIKFEEKVEQGGERWSKPHVATLSLHSLFELRTCMEKGSIMLDREASSLP
QLVEMIADHQIETGLLKPDLKDKVTYTLLRKHRHQTKKSNLRSLADIGKTVSSASRMFSN
PDNGSPAMTHRNLTSSSLNDISDKPEKDQLKNKFMKKLPRDAEASNVLVGEVDFLDTPFI
AFVRLQQAVMLGALTEVPVPTRFLFILLGPKGKAKSYHEIGRAIATLMSDEVFHDIAYKA
KDRHDLIAGIDEFLDEVIVLPPGEWDPAIRIEPPKSLPSSDKRKNMYSGGENVQMNGDTP
HDGGHGGGGHGDCEELQRTGRFCGGLIKDIKRKAPFFASDFYDALNIQALSAILFIYLAT
VTNAITFGGLLGDATDNMQGVLESFLGTAVSGAIFCLFAGQPLTILSSTGPVLVFERLLF
NFSKDHSFDYLEFRLWIGLWSAFMCLILVATDASFLVQYFTRFTEEGFSSLISFIFIYDA
FKKMIKLADYYPINSDFRVGYNTHFSCACLPPDPVNLSVSNDTTLAPEDLPTVSSTDMYH
NATFDWAYLSKKECVKFGGKLVGNNCDFVPDITLMSFILFLGTYTSSMAMKKFKTSRYFP
TTARKLISDFAIILSILIFCVIDALVGVDTPKLIVPSEFKPTSPHRGWFVPPFGGNPWWV
CLAAAIPALLVTILIFMDQQITAVIVNRKEHKLKKGAGYHLDLFWVAILMVVCSFMALPW
YVAATVISIAHIDSLKMETETSAPGEQPKFLGVREQRVTGTLVFILTGLSVFMAPILKFI
PMPVLYGVFLYMGVASLNGVQFMDRLKLLLMPLKHQPDFIYLRHVPLRRVHLFTSLQVLC
LALLWILKSTVAAIIFPVMILALVAVRKGMDYLFSQHDLSFLDDVIPEKDKKKKEDEKKK
KKKKGSLDSDNDDSDCPYSEKVPSIKIPMDITEQQPFLSDNKPLDRERSSTFLERHTSC
NT seq 3240 nt NT seq  +upstreamnt  +downstreamnt
atggaggatgaagctgtcctggacagaggggcttccttccttaaacatgtgtgtgacgaa
gaagaagtagaaggtcaccacacgatctacattggggtccatgtgcccaagagctaccgg
agaaggagacgccataagagaaaggctgggcacaaggaaaagaaggagaaggaaaggatc
tctgagaactattccgacaaatcagatgtggagaatgcggacgaatccagcagcagcatc
ctcaagccgctcatctccccggccgcagaacgtatccgattcatcttgggagaggaagat
gacagcccagcacctcctcagctcttcacggaactcgatgagctgctggctgtggatgga
caggagatggaatggaaggagacagccaggtggattaagtttgaagagaaagtggaacag
ggtggggagcgatggagcaaaccccatgtggccaccttgtccctgcacagcttgtttgag
ctgaggacatgtatggagaaaggatccatcatgcttgaccgggaggcctcctctctccca
cagctggtggagatgattgcagaccaccagatcgagacaggcctcttgaagcccgacctc
aaggataaggtcacctatacgctgctgcggaaacaccgacatcaaaccaagaaatccaac
cttcggtccctggctgacattgggaagacagtctccagtgcaagtaggatgttcagcaac
cctgataacggtagcccagctatgacccacaggaatctgacatcctccagtctcaatgac
atttctgataaaccagagaaggaccagctgaagaataaattcatgaaaaaactgccccgt
gatgcagaagcttccaacgtgctcgttggggaggttgacttcttggacactcccttcatt
gcctttgttcgtctacagcaggctgtcatgctgggtgccctgactgaggtgcctgtgccc
acaaggttcttgttcattctcttaggtccaaaggggaaagccaagtcctaccatgagatc
ggaagagccatcgccaccttgatgtctgacgaggtgttccacgatatcgcttacaaagcg
aaagatagacacgacctgattgctggcattgacgagttcttagatgaagtcattgtcctt
ccacctggggaatgggacccggcaatcagaatagaacctccaaagagcctcccatcatct
gacaaaaggaagaatatgtactcaggtggagagaacgttcagatgaatggggacacacct
catgatggaggccacggaggaggaggccacggtgactgtgaagaactacagagaactggc
cggttctgtggtggattaattaaggacataaagaggaaagcaccattttttgccagtgac
ttttatgacgctttaaatattcaggctctctcggcaattctcttcatctatctggcgacg
gtaaccaacgccatcactttcggaggcctgctcggggatgccactgacaacatgcagggt
gtgttggagagtttcctgggcactgctgtctctggcgccatcttttgcctttttgcgggt
caaccgctcaccatcttgagtagcacgggacctgttctggtgtttgagaggcttcttttc
aacttcagcaaggaccatagttttgactacttggagtttcgtctttggattggcctgtgg
tcagccttcatgtgtctcatcctggtggccactgatgccagcttcctggttcagtacttc
acccgtttcacggaagaaggattctcctctctgatcagcttcatcttcatctatgatgct
ttcaagaagatgatcaagctggcagattactatcccatcaactctgacttcagagtgggc
tacaacactcacttctcctgtgcttgcctgccacctgacccagttaatctctcagtatct
aatgataccacactagccccagaggacctgccaaccgtttcttctactgacatgtaccac
aatgctacctttgactgggcctacttgtcaaagaaagagtgtgtgaaatttggaggaaag
ctcgtgggaaacaactgtgacttcgtgcctgacatcacactcatgtccttcatcctcttc
ctgggcacttacacctcttctatggccatgaagaaattcaaaaccagccgctattttcca
accacagcaagaaaactgatcagcgattttgccatcatcctgtccattctcatattctgt
gtaatagacgccctcgtcggtgtggatactccgaagctaattgtgccaagtgagttcaag
ccaacaagccctcaccggggttggtttgtcccaccctttggaggaaacccctggtgggtg
tgccttgctgctgctatcccggctttgctagtcaccatcctgattttcatggaccagcaa
atcacggccgtgattgtgaacaggaaagaacataagctcaagaagggagctggctatcac
ctggacctgttttgggtcgccatcctcatggtggtgtgctccttcatggctcttccctgg
tatgtggctgctactgtcatctccatcgctcacatcgacagtctgaagatggagacagag
acttctgcgcctggagaacaaccaaagtttctgggagtgagagaacaacgagtcactgga
acccttgtgtttattctgactggcctgtcagtctttatggctcccatcttgaagtttatc
cccatgcctgttctgtatggcgtgttcttgtatatgggggtggcctcactgaacggtgtg
cagttcatggaccgtcttaagctgcttctcatgcccctgaagcatcaacctgacttcatc
tacctgcgccacgtccccctgcgccgagtccacctgttcacctccctgcaggtgttgtgc
ctggctctgctctggatcctcaagtccacagtggctgcgattatttttccagttatgatc
ctggccctggtagctgtcagaaaaggtatggactacctcttctcccagcacgacctcagc
ttccttgatgatgtcattccagagaaggacaagaaaaagaaggaggatgagaagaagaag
aaaaagaagaaaggaagtctggatagcgacaacgacgattctgactgcccatactcagaa
aaggtccccagtattaaaattccaatggacatcacggaacagcaacctttcctaagtgat
aacaaacccttggacagagaaagatcctcaacattccttgaacgccacacatcatgctga

DBGET integrated database retrieval system