KEGG   Rattus norvegicus (rat): 84485
Entry
84485             CDS       T01003                                 

Gene name
Ccs
Definition
(RefSeq) copper chaperone for superoxide dismutase
  KO
K04569  copper chaperone for superoxide dismutase
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05014  Amyotrophic lateral sclerosis
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    84485 (Ccs)
   05022 Pathways of neurodegeneration - multiple diseases
    84485 (Ccs)
SSDB
Motif
Pfam: Sod_Cu HMA Fn3-like
Other DBs
NCBI-GeneID: 84485
NCBI-ProteinID: NP_445877
RGD: 620403
Ensembl: ENSRNOG00000047816
UniProt: Q9JK72
Position
1
AA seq 274 aa
MASKSGDGGTMCALEFTVQMSCQSCVDAVHKTLKGAAGVQNVEVQLENQMVLVQTTLPSQ
EVQALLESTGRQAVLKGMGSSQLKNLGAAVAIMEGSGTVQGVVRFLQLSSELCLIEGTID
GLEPGLHGLHVHQYGDLTKDCSSCGDHFNPDGASHGGPQDTDRHRGDLGNVHAEASGRAT
FRIEDKQLKVWDVIGRSLVVDEGEDDLGRGGHPLSKVTGNSGKRLACGIIARSAGLFQNP
KQICSCDGLTIWEERGRPIAGQGRKDSAQPPAHL
NT seq 825 nt   +upstreamnt  +downstreamnt
atggcttcgaagtcgggggacggtggaactatgtgtgcgttggagtttacagtacagatg
agttgtcagagctgcgtggacgctgtgcacaagaccctgaaaggggcggcgggtgtccag
aatgtggaagttcagttggagaaccagatggtgttggtgcagaccactttgcccagccag
gaggtgcaagcgctcctggaaagcacagggaggcaggctgtactcaagggcatgggcagc
agccaactaaagaatctgggagcagcagtggccattatggagggcagtggcaccgtacag
ggggtggtccgcttcctacagctgtcctctgagctctgcctgattgagggaaccatcgac
ggcctggagcctgggctgcatgggcttcatgtccatcagtatggggaccttaccaaggac
tgcagcagctgtggggaccattttaaccctgatggagcatctcatgggggtcctcaggac
actgatcggcaccggggagatctgggcaatgttcacgctgaagctagtggccgagctacc
ttccggatagaggataaacagctgaaggtgtgggatgtgattggccgcagtctggttgtt
gatgagggagaagatgacctgggccggggaggccatcccttatccaaggtcacagggaat
tctgggaagaggttggcctgtggcatcattgcacgctctgctggccttttccagaatccc
aagcagatctgctcctgtgatgggctcactatctgggaggagcgaggccggcccattgct
ggccaaggccgaaaggactcagcccaaccccctgctcacctctga

DBGET integrated database retrieval system