KEGG   Rattus norvegicus (rat): 84490Help
Entry
84490             CDS       T01003                                 

Gene name
Fen1, FEN-1
Definition
(RefSeq) flap structure-specific endonuclease 1
  KO
K04799  flap endonuclease-1 [EC:3.-.-.-]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03030  DNA replication
rno03410  Base excision repair
rno03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    84490 (Fen1)
   03410 Base excision repair
    84490 (Fen1)
   03450 Non-homologous end-joining
    84490 (Fen1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:rno03032]
    84490 (Fen1)
   03400 DNA repair and recombination proteins [BR:rno03400]
    84490 (Fen1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    84490 (Fen1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.-  
   3.-.-  
    3.-.-.-  
     84490 (Fen1)
DNA replication proteins [BR:rno03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   Other elongation factors
    84490 (Fen1)
 Prokaryotic type
   Elongation factors (archaeal)
    Other elongation factors
     84490 (Fen1)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     84490 (Fen1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   84490 (Fen1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: XPG_N XPG_I 5_3_exonuc XRN_N HHH_5 RRF
Motif
Other DBs
NCBI-GeneID: 84490
NCBI-ProteinID: NP_445882
RGD: 621821
Ensembl: ENSRNOG00000020531
UniProt: Q5XIP6
Position
1q43
AA seq 380 aa AA seqDB search
MGIQGLAKLIADVAPSAIRENDIKSYFGRKVAIDASMSIYQFLIAVRQGGDVLQNEEGET
TSHLMGMFYRTIRMMENGIKPVYIFDGKPPQLKSAQLAKRSERRAEAEKQLQQAQEAGAE
EEVEKFTKRLVKVTKQHNDECKHLLSLMGIPYLDAPSEAEASCAALAKAGKVYAAATEDM
DCLTFGSPVLMRHLTASEAKKLPIQEFHLSRVLQELGLNQEQFVDLCILLGSDYCESVRG
IGPKRAVDLIQKHKSIEEIVRRLDPSKYPVPENWLHKEARQLFLEPEVVDPESVELKWSE
PNEEELVKFMCGEKQFSEERIRSGVKRLNKSRQGSTQGRLDDFFKVTGSLSSAKRKEPEP
KGPAKKKAKTGAAGKFRRGK
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgggaattcaaggccttgccaaactaattgctgatgtggcccccagtgccatccgtgag
aatgacatcaagagctactttggtcgcaaagtggccattgatgcctccatgagcatttac
cagttcctgattgctgttcgtcagggtggggacgtactgcagaacgaggagggggagacc
accagccacctgatgggcatgttctaccgtaccatccgcatgatggagaatggcatcaag
ccggtgtatatctttgatggcaaaccaccacagctgaagtcggcccagctggccaaacgc
agtgagcggcgtgcagaggccgagaagcagctgcagcaggctcaggaggcgggggcagag
gaggaggtggaaaagttcaccaagcggcttgtgaaggtcaccaagcaacacaacgatgag
tgcaaacacctgctgagcctcatgggcatcccataccttgatgcgcccagcgaggcagag
gccagctgtgctgccctggcaaaggctggcaaagtctatgccgcagccacggaggacatg
gactgcctcacttttggcagccccgtgctaatgcgacacttaactgccagtgaggccaag
aagctgcccatccaagagttccacctgagccgcgtcctgcaagagctgggtctgaaccag
gagcagtttgtggatctgtgcatcctgctgggtagcgactactgtgagagtgtccgtggc
attggacccaagcgggctgtggacctcatccagaagcacaagagcatcgaggagatcgtg
aggcggctggatcccagcaagtaccctgttccggaaaactggctccacaaggaagcccgg
cagctcttcctggagccggaagtagtggacccagagtctgtggagctgaagtggagtgag
ccaaacgaagaagagttggtcaaatttatgtgcggtgaaaagcagttttctgaagagcgg
attcgtagtggggtcaaacggctgaataagagccgccaaggcagcacccagggacgccta
gatgatttcttcaaggtgacaggctcactctcctcagccaagcgcaaggagccagagccc
aaggggcctgccaagaagaaagcaaagactggggcagcagggaagttccgaaggggaaaa
taa

DBGET integrated database retrieval system