KEGG   Rattus norvegicus (rat): 84492
Entry
84492             CDS       T01003                                 

Gene name
Tec
Definition
(RefSeq) tec protein tyrosine kinase
  KO
K07364  tyrosine-protein kinase Tec [EC:2.7.10.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04380  Osteoclast differentiation
rno04660  T cell receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    84492 (Tec)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    84492 (Tec)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    84492 (Tec)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     84492 (Tec)
Protein kinases [BR:rno01001]
 Non-receptor tyrosine kinases
  TEC family
   84492 (Tec)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 PH SH3_1 BTK SH3_9 SH3_2 SH3_3 SH3_10 Kinase-like SH3_4 APH
Other DBs
NCBI-GeneID: 84492
NCBI-ProteinID: NP_445884
RGD: 620973
Ensembl: ENSRNOG00000002278
UniProt: B2RYC7
Position
14p11
AA seq 629 aa
MNFNTILEEILIKRSQQKKKTSPLNYKERLFVLTKSVLTYYEGRAEKKYRKGFIDISKIK
CVEIVKNDDGIIPCQNKFPFQVVHDANTLYIFAPSPQSRDRWVKKLKEEIKNNNNIMIKY
HPKFWADGSYQCCRQTEKLAPGCEKYNLFESSIRKTLPPAPEIKRRPPPPIPPEEENTEE
IVVAMYDFQATEAHDLRLERGQEYIILEKNDTHWWRARDKYGSEGYIPSNYVTGKKSNNL
DQYEWYCRNTNRSKAEQLLRTEDKEGGFMVRDSSQPGLYTVSLYTKFGGEGSSGFRHYHI
KETATSPKKYYLAEKHAFGSIPEIIEYHKHNAAGLVTRLRYPVSTKGKNAPTTAGFSYDK
WEINPSELTFMRELGSGLFGVVRLGKWRAQYKVAIKAIREGAMCEEDFIEEAKVMMKLTH
PKLVQLYGVCTQQKPIYIVTEFMERGCLLNFLRQRQGHFSRDVLLSMCQDVCEGMEYLER
NSFIHRDLAARNCLVNEAGVVKVSDFGMARYVLDDQYTSSSGAKFPVKWCPPEVFNYSRF
SSKSDVWSFGVLMWEIFTEGRMPFEKNTNYEVVTMVTRGHRLPRPKLASKYLYEVMLRCW
QERPEGRPSFEDLLRTIDELVECEETFGR
NT seq 1890 nt   +upstreamnt  +downstreamnt
atgaattttaacactatcctagaagagattcttattaaaaggtcccagcagaaaaagaag
acatcacccttaaactacaaagagagactttttgtacttacaaaatccgtgttaacctac
tatgagggtcgagcggagaaaaaatacagaaagggattcattgatatttcaaaaatcaag
tgtgtggagatagtgaagaacgacgatgggatcattccctgtcaaaataaatttccattc
caggttgttcacgatgctaacacactttatatttttgcacctagtccacaaagcagggac
cggtgggtgaagaagttaaaagaagagataaagaacaacaataatatcatgattaaatat
catcctaaattttgggctgacggaagttaccagtgctgtagacaaacggaaaaactggcg
cctggatgtgaaaagtacaatctttttgagagtagtataagaaagaccctgcctcctgca
ccggaaataaagagaaggcctcctccaccaatccctccagaggaagaaaatactgaagaa
atagttgtagcgatgtatgacttccaagcaacagaagcacatgacctcaggttagagaga
ggccaagagtatatcatcctcgaaaagaatgacacccattggtggagagcaagagataag
tatgggagtgaaggatatatcccaagtaattatgtcacaggaaagaagtccaacaactta
gatcaatatgagtggtattgccgaaacaccaacagaagcaaagcagagcagctcctccgg
acagaagacaaggaagggggttttatggtgagagactccagtcaaccaggcttgtacaca
gtctccctttacacaaagttcgggggagaaggctcatcaggcttcaggcattatcacata
aaggaaacagcaacatccccaaagaagtattacctggcagaaaagcatgcttttgggtcc
attcctgagatcattgagtatcacaagcacaacgcagcaggacttgtcaccaggctgagg
tacccggttagtacaaaggggaagaacgcgcccactactgctggcttcagctatgataag
tgggagattaacccctcagagctgacctttatgagggagttggggagtggactctttgga
gtggtgaggcttggcaagtggcgggcccagtacaaagtagccatcaaagctatccgggaa
ggcgccatgtgtgaagaggatttcatagaggaagctaaagtcatgatgaagctgacacac
cccaagctggtacagctctacggcgtgtgcacccagcagaagcccatttacatcgttacc
gagttcatggaacggggctgccttctgaatttcctccggcagagacaaggccatttcagc
agagatgtcctgctgagcatgtgccaggatgtgtgtgaagggatggagtacctggagaga
aacagcttcatccacagagacttggctgctagaaattgtctagtgaatgaagcaggagtt
gtcaaagtatctgatttcggaatggccaggtacgtcctggacgatcagtacacaagttcc
tctggtgccaagttccctgtgaagtggtgtcccccagaagtgtttaattacagccgcttt
agcagcaagtcagacgtctggtcattcggtgtgctaatgtgggagatattcacagaaggc
aggatgccctttgagaagaacaccaattacgaagtggtaaccatggttactcgaggtcac
cgacttccccggccaaagttggcttccaaatatttgtatgaggtgatgctgaggtgctgg
caagagagaccagagggaaggccttcgtttgaagacttgctacgtacgatagatgaacta
gtcgaatgcgaagaaacttttggaagataa

DBGET integrated database retrieval system