KEGG   Rattus norvegicus (rat): 84510Help
Entry
84510             CDS       T01003                                 

Gene name
Stmn2, Scg10, Scgn10
Definition
(RefSeq) stathmin 2
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Stathmin HTH_8
Motif
Other DBs
NCBI-GeneID: 84510
NCBI-ProteinID: NP_445892
RGD: 68947
Ensembl: ENSRNOG00000011705
UniProt: P21818
Position
2q23
AA seq 179 aa AA seqDB search
MAKTAMAYKEKMKELSMLSLICSCFYPEPRNINIYTYDDMEVKQINKRASGQAFELILKP
PSPISEAPRTLASPKKKDLSLEEIQKKLEAAEGRRKSQEAQVLKQLAEKREHEREVLQKA
LEENNNFSKMAEEKLILKMEQIKENREANLAAIIERLQEKERHAAEVRRNKELQVELSG
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaacagcaatggcctacaaggaaaaaatgaaggagctgtctatgctgtcactg
atctgctcctgcttctacccggagcctcgcaacatcaacatctacacctacgatgacatg
gaggtgaagcagatcaacaagcgtgcttccggccaggctttcgagctgatcttaaagccc
ccgtctcccatctcggaagctccacgaactctagcttctccaaagaagaaagacctgtct
ctggaggagatccagaaaaagctggaggctgcagaggggcgaaggaagtctcaggaggcc
caggtgctgaagcagttggcagagaagagggagcacgagcgagaagtcctccagaaggct
ttggaggagaataacaacttcagcaagatggcggaggagaagctgatcctgaaaatggaa
caaattaaggaaaaccgtgaggctaatctagctgctatcattgaacgtctgcaggaaaag
gagaggcatgctgccgaggtgcgcaggaacaaggaactgcaggttgaactgtctggctga

DBGET integrated database retrieval system