KEGG   Rattus norvegicus (rat): 84511
Entry
84511             CDS       T01003                                 

Gene name
Slco1c1, Bsat1, Oatp14, Slc21a14
Definition
(RefSeq) solute carrier organic anion transporter family, member 1c1
  KO
K08747  solute carrier organic anion transporter family, member 1C
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04919  Thyroid hormone signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    84511 (Slco1c1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    84511 (Slco1c1)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC21/ASLCO: Organic anion transporter
   84511 (Slco1c1)
SSDB
Motif
Pfam: OATP MFS_1 Kazal_2 Kazal_1
Other DBs
NCBI-GeneID: 84511
NCBI-ProteinID: NP_445893
RGD: 628660
Ensembl: ENSRNOG00000009740
UniProt: Q9EPZ7
Position
4q44
AA seq 716 aa
MDTSSKENAHLFHKNSAQPAGGPSFKAGYPSTEEARPCCGKLKVFLGALSFVYFAKALTE
GYLKSTITQIERRFDIPSSLVGIIDGSFEIGNLLVITFVSYFGAKLHRPKIIGAGCLVMG
FGTMLIAVPQFFMEKYSYEKYERYSPSSNLTPNISPCYLESSSPSPRSIVGKSQNKINDE
CEVDTSSSMWVYVFLGNLLRGLGETPIQPLGIAYLDDFASEDNAAFYIGCVQTVAIIGPI
FGFLLGSLCAKLYVDIGFVNLDHITITPKDPQWVGAWWLGYLIAGFLSLLAAVPFWCLPK
TLPRSQSREDSGSSSEKSKFITDDPVNYQMAPREESMKIMEMARDFLPSLKSLFRNPVYI
LYLCASTVQFNSLFGMVTYKPKYIEQQYGQSSSKANFVIGLINIPAVALGIFSGGIVMKK
FRLGICEATKLYLGSSVFGYLLFLSLFALGCENSSVAGLTVSYQGTKPVSYHERALFSDC
NSRCKCSDSKWEPMCGDNGITYASACLAGCQSSSRSGKNIIFSNCTCVGFAAPKSGNWSG
MMGRCQKDNGCSQMFLYFLVISVITSYTLSLGGIPGYILLLRCIQPQLKSFALGIYTLAV
RVLAGIPAPVYFGVLIDTSCLKWGFKKCGSRGSCRLYDSHAFRHIYLGLTTLLGTVSVFL
STAVLLVLKKKYVSKRSSFITAREKIVMSSSVKKETCAARDHGLQPKYWPGKETRL
NT seq 2151 nt   +upstreamnt  +downstreamnt
atggacacttcatccaaagaaaatgcccatttgttccacaaaaattcagcgcaacctgcc
ggagggccatcttttaaagcgggatatccgtccacagaggaagcgcggccatgctgtgga
aaactcaaggtgttcttaggtgccctgtcttttgtttactttgccaaagcattgacagaa
ggctacctgaagagcactattactcagatagagagaaggtttgatatcccttcctctctg
gtgggaataattgatggtagtttcgaaattgggaatctcctggtcataacattcgttagc
tactttggtgccaaacttcacaggccaaaaataattggagcaggatgcctggtcatgggc
tttggaactatgctcatcgcagttccccagttcttcatggagaagtacagctatgagaaa
tatgagaggtattctccctcctccaacctcactcccaacatctctccgtgctacctagag
tccagcagtccatcaccacgctcaatcgtggggaaatcacaaaacaagataaacgatgag
tgtgaagtggataccagttcctccatgtgggtttatgtcttcctgggaaaccttctccga
ggattaggggaaactcctatccaacccctgggcatcgcctacctggatgatttcgccagt
gaagacaatgctgccttctacatcgggtgtgtgcagacagtggcaattatagggcccatt
ttcggcttcctcttgggttcattatgtgccaaactctatgttgatattggctttgtgaat
ctagaccacataactatcaccccaaaggatccccagtgggtcggggcctggtggcttggt
tacctaatagcagggttcctaagtcttcttgcagccgtgcctttctggtgcttacccaag
actctaccaagatcccaaagtagagaggactccggctcctcctctgagaaatccaagttc
attacagatgaccctgttaactaccaaatggcccccagagaagaaagcatgaaaatcatg
gaaatggcgagggattttcttccatcactgaagagtctttttagaaatccagtatacatc
ttatacttgtgtgcaagcactgttcagttcaattctctattcggcatggtcacatataaa
ccaaagtacattgagcagcagtatgggcagtcttcctccaaagccaactttgtcattggt
ctcatcaatattcctgcagtggcccttggaatattctctgggggaatagttatgaaaaaa
ttcaggctgggtatttgtgaagctacaaaactctacttgggatcatctgtctttggctac
ctcctcttcctctctctgtttgcactgggatgtgaaaattccagtgtggccggactaact
gtctcctaccaaggaaccaaacctgtctcttatcatgaacgagctctcttttcagattgc
aactcaagatgcaaatgttcagactcaaaatgggagcccatgtgtggggacaatgggatt
acctatgcgtcggcttgtcttgctggctgtcaatcctccagccggagtggaaagaacatt
atattttctaactgcacttgtgtgggatttgctgcccctaaatcaggaaactggtcaggc
atgatgggcaggtgtcagaaagataatggatgttcccaaatgtttctgtatttccttgtg
atttcagtcatcacatcatatacattatctctaggtggcatacctggatatatattactc
ttgaggtgcattcaaccacaacttaagtcttttgctctgggcatctacaccttagcagta
agagttcttgcaggaatcccagcccccgtgtactttggtgttttaatcgacacttcgtgc
ctcaagtggggatttaagaaatgtggaagcagaggctcctgcagactgtacgactctcat
gctttcagacatatatacctgggactaaccacgctcttgggcacggtgtctgtcttccta
agcacggctgtgcttttggttttaaagaaaaaatacgtctcaaaacgcagcagcttcata
accgcaagagaaaaaatagtgatgtcctcaagcgtcaaaaaggagacgtgtgccgcaagg
gatcatgggttgcagcccaagtactggccaggcaaggagacccgactttaa

DBGET integrated database retrieval system