KEGG   Rattus norvegicus (rat): 84556
Entry
84556             CDS       T01003                                 

Gene name
Rims1
Definition
(RefSeq) regulating synaptic membrane exocytosis protein 1
  KO
K15291  regulating synaptic membrane exocytosis protein 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04721  Synaptic vesicle cycle
rno04723  Retrograde endocannabinoid signaling
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    84556 (Rims1)
   04721 Synaptic vesicle cycle
    84556 (Rims1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    84556 (Rims1)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Acrosomal exocytosis proteins
    84556 (Rims1)
  Small GTPases and associated proteins
   Rab associated proteins
    84556 (Rims1)
SSDB
Motif
Pfam: C2 PDZ FYVE_2 PDZ_6 Nudix_N_2 IBR
Other DBs
NCBI-GeneID: 84556
NCBI-ProteinID: NP_439894
RGD: 620000
Ensembl: ENSRNOG00000011000
UniProt: Q9JIR4
Structure
PDB: 
2Q3X 1ZUB

Position
9
AA seq 1553 aa
MSSAVGPRGPRPPTVPPPMQELPDLSHLTEEERNIIMAVMDRQKEEEEKEEAMLKCVVRD
MAKPAACKTPRNAESQPHQPPLNIFRCVCVPRKPSSEEGGPERDWRLHQQFESYKEQVRK
IGEEARRYQGEHKDDAPTCGICHKTKFADGCGHLCSYCRTKFCARCGGRVSLRSNNEDKV
VMWVCNLCRKQQEILTKSGAWFFGSGPQQPSQDGTLSDTATGAGSEVPREKKARLQERSR
SQTPLSTAAVSSQDTATPGAPLDRNKGAEPSQQALGPEQKQASRSRSEPPRERKKAPGLS
EQNGKGGQKSERKRVPKSVVQPGEGIADERERKERRETRRLEKGRSQDYSDRPEKRDNGR
VAEDQKQRKEEEYQTRYRSDPNLARYPVKAPPEEQQMRMHARVSRARHERRHSDVALPHT
EAAAAAPAEATAGKRAPATARVSPPESPRARAPAAQPPTEHGPPPPRPAPGPAEPPEPRV
PEPLRKQGRLDPGSAVLLRKAKREKAESMLRNDSLSSDQSESVRPSPPKPHRPKRGGKRR
QMSVSSSEEEGVSTPEYTSCEDVELESESVSEKGDLDYYWLDPATWHSRETSPISSHPVT
WQPSKEGDRLIGRVILNKRTTMPKESGALLGLKVVGGKMTDLGRLGAFITKVKKGSLADV
VGHLRAGDEVLEWNGKPLPGATNEEVYNIILESKSEPQVEIIVSRPIGDIPRIPESSHPP
LESSSSSFESQKMERPSISVISPTSPGALKDAPQVLPGQLSVKLWYDKVGHQLIVNVLQA
TDLPPRVDGRPRNPYVKMYFLPDRSDKSKRRTKTVKKLLEPKWNQTFVYSHVHRRDFRER
MLEITVWDQPRVQDEESEFLGEILIELETALLDDEPHWYKLQTHDESSLPLPQPSPFMPR
RHIHGESSSKKLQRSQRISDSDISDYEVDDGIGVVPPVGYRASARESKATTLTVPEQQRT
THHRSRSVSPHRGDDQGRPRSRLPNVPLQRSLDEIHPTRRSRSPTRHHDASRSPADHRSR
HVESQYSSEPDSELLMLPRAKRGRSAESLHMTSELQPSLDRARSASTNCLRPDTSLHSPE
RERHSRKSERCSIQKQSRKGTASDADRTHRQGSPTQSPPADTSFGSRRGRQLPQVPVRSG
SIEQASLVVEERTRQMKMKVHRFKQTTGSGSSQELDHEQYSKYNIHKDQYRSCDNASAKS
SDSDVSDVSAISRASSTSRLSSTSFMSEQSERPRGRISSFTPKMQGRRMGTSGRAIIKST
SVSGEIYTLERNDGSQSDTAVGTVGAGGKKRRSSLSAKVVAIVSRRSRSTSQLSQTESGH
KKLKSTIQRSTETGMAAEMRKMVRQPSRESTDGSINSYSSEGNLIFPGVRVGPDSQFSDF
LDGLGPAQLVGRQTLATPAMGDIQIGMEDKKGQLEVEVIRARSLTQKPGSKSTPAPYVKV
YLLENGACIAKKKTRIARKTLDPLYQQSLVFDESPQGKVLQVIVWGDYGRMDHKCFMGVA
QILLEELDLSSMVIGWYKLFPPSSLVDPTLAPLTRRASQSSLESSSGPPCIRS
NT seq 4662 nt   +upstreamnt  +downstreamnt
atgtcctcggccgtggggccccgaggtcctcgcccacccacggtgcctccccctatgcaa
gaactgcccgacctgagccacctgaccgaggaggagaggaacattatcatggcagtgatg
gaccggcagaaggaagaggaggaaaaagaagaggccatgctcaagtgtgttgtcagggac
atggcgaagcctgctgcctgcaaaacaccaagaaatgctgaaagccagccccatcaacca
ccactgaacattttcagatgtgtctgtgttcccagaaagccaagcagcgaagagggaggc
ccagaaagagactggagattgcatcaacagtttgaaagctacaaggagcaagtgagaaaa
atcggagaggaagcgaggcgttaccagggcgagcacaaggatgatgccccgacgtgtgga
atctgtcataagacaaagtttgctgatggatgtggccatctctgctcctattgtcgcacc
aagttctgtgcacgctgcggaggccgtgtgtctctgcgatcgaacaatgaggacaaagtg
gttatgtgggtatgcaatttatgtcgaaagcaacaagaaatcttaacgaaatctggagcg
tggttctttggaagtggccctcagcagcctagtcaagatgggactctgagtgacacggcc
acaggtgctggatctgaggtgccaagagaaaagaaagcaaggctccaagagcgatcaagg
tctcagacgcccttgagtacagcagctgtctcttcccaagacactgctacccccggtgca
ccgttggacaggaacaaaggggctgagccctcacagcaagccttgggtcctgaacagaag
caggcatcaagatcaagaagcgagccaccgagggaaaggaagaaggctccagggctttca
gagcagaatggcaagggaggccagaagagcgagcgcaaacgtgtccccaagtctgtggtg
caacccggggaagggatcgcggatgagagggagaggaaagagaggcgggaaacccgcagg
ttggagaaagggcgctcccaggactactcagaccggcctgagaaacgcgacaatggcagg
gtggcggaagaccagaagcagaggaaggaggaggagtaccagactaggtaccgcagcgac
cctaacctggctcgctacccggtgaaggcgccgccagaggagcagcagatgcgcatgcac
gcccgggtgtcccgagcgaggcacgagcggcgccacagcgacgtggcgctcccgcacacc
gaggcagctgccgccgcgccggctgaggccacggcgggcaagcgcgcgccggccaccgcc
agggtctctcccccggagtccccgcgcgcacgcgcgcccgccgcccagcctcccaccgag
cacgggccaccgccgccgcggccagccccgggtcccgcagagccacccgagccgcgcgtc
cccgagccgctccgtaagcagggccgcctggacccgggctcggccgtgcttctgcgcaag
gccaagcgcgagaaggcggagagcatgctgcggaacgactcgctgagctccgatcagtcc
gagtccgtgcggccatccccgcccaagcctcaccggcccaagcggggaggcaagagacgt
cagatgtcggtgagcagctcggaggaggagggcgtgtccacaccggagtacacgagctgc
gaggacgtggagctggagagcgagagcgtgagcgagaaaggtgacttggattactactgg
ttggatcccgccacgtggcacagcagggaaacgtcgcctatcagttcgcatcctgtaacg
tggcagccgtctaaagagggagatcgactaatcggccgtgttattcttaacaaaagaaca
accatgcccaaagaatcaggtgcattattgggtctgaaggtggttggaggaaaaatgacg
gacttagggcgccttggtgctttcatcaccaaagtaaagaagggcagcctggcagacgtc
gtcggacacctaagagcaggggacgaagtcctagagtggaatggtaaacccctgccggga
gcaacaaacgaagaagtttacaacattatcttagaatcaaaatcagaacctcaagttgag
attattgtttcaaggcctattggtgacatccccaggatccctgagagttcccatcctccc
ctggagtccagttcaagttcctttgaatctcagaaaatggaaaggccttctatttctgtt
atttctccaaccagccctggagctctgaaagatgccccacaagtcttaccagggcaactc
tcagtgaagctatggtatgataaagtggggcaccagctgattgtaaatgttctacaagca
acagatctaccccctagagtagatggccgtcccaggaatccctatgtaaaaatgtatttt
cttccagatagaagcgacaaaagtaaaaggagaaccaaaacagtaaagaaacttctagag
ccaaaatggaaccagacatttgtctactcacacgtacatcgtagagattttcgagagcga
atgttagagattaccgtgtgggaccagccgagagtacaggacgaagagagtgaatttctt
ggagagatcctcatagagttggaaacagcgcttttagatgatgagccccattggtataaa
ctccagacacatgacgaatcttcactacctctgcctcagccatcaccgttcatgcccagg
cggcatattcatggagagagctccagcaaaaagctacaaagatctcagcgaatcagtgat
agtgacatctcagattatgaggttgatgatggtattggagtagtgcctccagtgggttat
agagctagtgctagagagagtaaagcaaccacgttaacagtgccagagcaacaaagaact
acacatcaccgctcacgttccgtgtctcctcatcgcggcgatgatcagggaaggcctcgt
tcacgtttaccaaatgtgccattacagaggagcttagatgaaattcatccaacacgaagg
tcacgttctccaacccgacaccatgatgcctcccgaagcccggccgatcacagatccaga
catgtggaaagtcaatattcgtcagagccagacagtgagcttctcatgctgcccagagca
aaacgaggacgaagtgcagaaagcctacacatgaccagtgaactgcagccctctcttgac
agggctaggagtgctagtaccaactgcttgagaccagatactagtttgcattcaccagaa
cgagaaaggcactccagaaagtctgaaagatgtagcatccaaaaacagtctaggaaaggc
acagcctctgatgcagacagaacgcaccgacaaggaagcccaacccagtctcctccagca
gacacatccttcggcagtcgccgtggaagacagctcccacaggtgccagttcgaagcggc
agtatagaacaagcaagcttagtagtggaggagcgaacgagacagatgaaaatgaaagtt
caccgatttaagcagacaacagggtctgggtctagtcaagaacttgaccacgagcaatac
tccaagtacaacatacataaagatcagtacagaagctgtgataacgcgtctgccaagtct
tcagatagtgatgtcagtgatgtgtccgccatttccagagccagcagtacctcacgcctc
agcagcacaagctttatgtcagagcagtctgagcgccccaggggtaggatcagttcattt
acccccaaaatgcaaggcagacggatggggacttcaggaagagccatcatcaagagcacc
agtgtaagtggagagatatatacactggaacgtaatgacggtagccagtcggacacggcc
gtgggtaccgtcggagccggtggaaagaaacgaagatccagcctgagcgccaaagtggta
gccattgtgtctcgaagaagcaggagcacgtcacagctcagccagacagagtcgggccac
aagaagttgaaaagcaccatccagaggagtacggaaacaggaatggcagctgaaatgcgg
aagatggtgagacagccgagccgggagtccacggatggcagcatcaacagttatagctcg
gaaggaaacttgatatttcctggagttcgagtaggacccgacagtcagttcagtgatttc
cttgatgggttgggaccagcgcagctcgttggccgtcagacgctcgccaccccggccatg
ggcgatatccaaatcgggatggaggataagaagggtcagttggaggttgaggttatcaga
gcccggagccttacacaaaaacctggttccaaatctacacccgctccctatgtgaaagta
tatcttttggaaaatggagcctgtattgccaaaaagaagacaagaattgcacggaaaact
ctcgatcctttgtatcagcagtccctggtttttgatgaaagtccacagggtaaagttctt
caggtgattgtctggggtgactatggaagaatggaccacaaatgctttatgggtgtggct
caaatcttgttggaagaacttgatctatccagcatggtgattggatggtataaattgttc
cctccgtcctcactggtggatcccactctcgctcccctgacccgccgggcttcccaatca
tctctggaaagttcgtccgggcctccctgcatccggtcatag

DBGET integrated database retrieval system