KEGG   Rattus norvegicus (rat): 84573Help
Entry
84573             CDS       T01003                                 

Gene name
Otof
Definition
(RefSeq) otoferlin
  KO
K19949  otoferlin
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    84573 (Otof)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    84573 (Otof)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: C2 Ferlin_C FerB FerI
Motif
Other DBs
NCBI-GeneID: 84573
NCBI-ProteinID: NP_001263649
RGD: 620646
Ensembl: ENSRNOG00000009967
UniProt: A0A0G2K867
Structure
PDB: 

Position
6q14
AA seq 1998 aa AA seqDB search
MALIVHLKTVSELRGRADRIAKVTFRGQSFYSRVLENCEDVADFDETFRWPVASSIDRNE
VLEIQIFNYSKVFSNKLIGTFRMVLQKVVEENRVEVSDTLIDDNNAIIKTSLSMEVRYQA
ADGTVGPWDDGDFLGDESLQEEEKDSQETDGLLPGSRPSTRTPGEKSFRRAGRSVFSAMK
LGKTRSHKEEPQRQDEPAVLEMEDLDHLAIRLGDGLDPDSVSLASVTALTSNVSNKRSKP
DIKMEPSAGRPMDYQVSITVIEARQLVGLNMDPVVCVEVGDDKKYTSMKESTNCPYYNEY
FVFDFHVSPDVMFDKIIKISVIHSKNLLRSGTLVGSFKMDVGTVYSQPEHQFHHKWAILS
DPDDISAGLKGYVKCDVAVVGKGDNIKTPHKANETDEDDIEGNLLLPEGVPPERQWARFY
VKIYRAEGLPRMNTSLMANVKKAFIGENKDLVDPYVQVFFAGQKGKTSVQKSSYEPLWNE
QVVFTDLFPPLCKRMKVQIRDSDKVNDVAIGTHFIDLRKISNDGDKGFLPTLGPAWVNMY
GSTRNYTLLDEHQDLNEGLGEGVSFRARLMLGLAVEILDTSNPELTSSTEVQVEQATPVS
ESCTGRMEEFFLFGAFLEASMIDRKNGDKPVTFEVTIGNYGNEVDGTSRPQRPRPRKEPG
DEEEVDLIQNSSDDEGDEAGDLASVSSTPPMRPQITDRNYFHLPYLERKPCIYIKSWWPD
QRRRLYNANIMDHIADKLEEGLNDVQEMIKTEKSYPERRLRGVLEELSCGCHRFLSLSDK
DQGHSSRTRLDRERLKSCMRELESMGQQAKSLRAQVKRHTVRDKLRLCQNFLQKLRFLAD
EPQHSIPDVFIWMMSNNKRIAYARVPSKDLLFSIVEEELGKDCAKVKTLFLKLPGKRGFG
SAGWTVQAKLELYLWLGLSKQRKDFLCGLPCGFEEVKAAQGLGLHSFPPISLVYTKKQTF
QLRAHMYQARSLFAADSTGLSDPFARVFFINQSQCTEVLNETLCPTWDQMLVFDNLELYG
EAHELRDDPPIIVIEIYDQDSMGKADFMGRTFAKPLVKMADEAYCPPRFPPQLEYYQIYR
GNATAGDLLAAFELLQIGPSGKADLPPINGPVDMDRGPIMPVPVGIRPVLSKYRVEVLFW
GLRDLKRVNLAQVDRPRVDIECAGKGVQSSLIHNYKKNPNFNTLVKWFEVDLPENELLHP
PLNIRVVDCRAFGRYTLVGSHAVSSLRRFIYRPPDRSAANWNTTVRLLRGYHMLCNGGPS
SCPTGEVVVSMEPEVPVKKLETLVKLDATSDAVVKVDVAEDEKERKKKKKKGPSEEAEEE
EPDESMLDWWSKYFASIDTMKEQLRQHETSGIDLEEKEEMDSTEGLKGPVKNKEKSRAAK
EEKKKKNQNPGPGQGSEAPEKKKAKIDELKVYPKELESEFDNFEDWLHTFNLLRGKTGDD
EDGSTEEERIVGRFKGSLCVYKVPLPEDVSREAGYDPTYGMFQGIPSNDPINVLVRIYVV
RATDLHPADINGKADPYIAIKLGKTDIRDKENYISKQLNPVFGKSFDIEASFPMESMLTV
AVYDWDLVGTDDLIGETKIDLENRFYSKHRATCGIAQTYSIHGYNIWRDPMKPSQILTRL
CKEGKVDGPHFGPHGRVKVANRVFTGPSEIEDENGQRKPTDEHVALSALRHWEDIPRVGC
RLVPEHVETRPLLNPDKPGIEQGRLELWVDMFPMDMPAPGTPLDISPRKPKKYELRVIVW
NTDEVVLEDDDFFTGEKSSDIFVRGWLKGQQEDKQDTDVHYHSLTGEGNFNWRYLFPFDY
LAAEEKIVMSKKESMFSWDETEYKIPARLTLQIWDADHFSADDFLGAIELDLNRFPRGAK
TAKQCTMEMATGEVDVPLVSIFKQKRVKGWWPLLARNENDEFELTGKVEAELHLLTAEEA
EKNPVGLARNEPDPLEKPNRPDTSFIWFLNPLKSARYFLWHTYRWLLLKLLLLLLLLLLL
ALFLYSLPGYLAKKILGA
NT seq 5997 nt NT seq  +upstreamnt  +downstreamnt
atggccctgatcgtccacctcaagactgtttctgagcttcgaggcagagctgatcggatc
gccaaagtcactttccgaggacagtccttctattcccgggtcctggagaactgcgaggat
gtggctgacttcgatgagacattccggtggccagtggctagcagcatcgacaggaatgaa
gtgttggagattcagattttcaactacagcaaagtcttcagcaacaaactaatcgggacc
ttccgcatggtgctgcagaaggtggtggaggagaatcgggtagaggtgtctgacacgctg
atcgatgacaacaatgctatcatcaagaccagcctaagcatggaggtccggtatcaagcc
gcagatggcacagtaggcccttgggatgatggagactttctgggagatgaatcccttcag
gaggaagagaaagacagccaggagacagatggtctgctacctggctcccgacccagcacc
cggacacccggcgagaagagctttcgaagagcgggaaggagtgtattctcggccatgaaa
ctcggcaagactcggtcccacaaagaggagccccaaagacaagatgagccagcggtgctg
gagatggaggacctggaccacctagccatccggctgggggatgggctggatcctgactca
gtgtctctagcctcggtcactgctctcaccagcaatgtctccaacaaacggtctaagcca
gatattaaaatggaaccgagtgctgggagacccatggattaccaggtcagcatcacagtg
attgaggctcggcagctggtgggtttgaacatggaccccgtggtgtgcgtggaggtgggc
gatgacaaaaaatacacatccatgaaggagtccacaaactgcccttactacaacgagtac
ttcgtctttgacttccacgtctctcctgatgtcatgtttgacaagatcatcaagatctcg
gttatccattctaagaacctgcttcgaagcggcactctggtgggctccttcaaaatggat
gtggggaccgtgtactcccagcctgaacaccagttccatcacaaatgggctatcctgtca
gaccccgatgacatctctgccgggctgaagggctatgtaaagtgtgatgtcgccgtggtg
ggcaagggagacaacatcaagacaccccacaaggccaacgagacagatgaggatgacatt
gaagggaacttgctgctccccgagggcgtgcccccagaacggcagtgggcccggttctac
gtgaaaatttaccgagcagagggactgccccggatgaacacaagcctcatggccaacgta
aagaaggcgttcatcggtgagaacaaggacctcgtcgacccctacgttcaagtcttcttt
gctggacagaagggcaaaacatcagtgcagaagagcagctatgagccgctgtggaatgag
caggtcgtctttacagatctgttccccccactctgcaagcgcatgaaggtgcagatccga
gactccgacaaggtcaacgacgtggccatcggcacccacttcatcgacctgcgcaagatt
tccaacgatggagacaaaggcttcctgcctacgctcggcccagcctgggtgaacatgtac
ggctccacacgcaactacacgctgctggacgagcaccaggacctgaatgagggcctgggt
gagggggtgtccttccgtgcccgcctcatgttgggactggctgtggagatcctagacacc
tccaacccagagctcaccagctccaccgaggtgcaggtggagcaggccacacctgtctca
gagagctgcacagggagaatggaagaatttttcctatttggagccttcctggaagcctca
atgatcgaccggaaaaatggggacaagccagtgacctttgaggtgaccataggaaactat
ggcaatgaagtcgatggtacatcccggccccagaggcctcggccccggaaggaacctggg
gatgaagaagaggtagacctgattcagaactccagtgacgacgagggtgatgaagccggg
gacctggcctcagtgtcctccaccccacctatgaggccccagatcacagacaggaactat
ttccacctgccctacctagagcgcaagccctgcatctacatcaagagctggtggcctgac
cagcggcgccgtctctacaacgcaaacatcatggaccacattgctgacaagctggaagaa
ggtctgaatgatgtccaggagatgatcaaaacggagaagtcctacccggagcgacgcctg
cggggtgtgctagaggaactcagctgtggctgccaccgcttcctctccctctcggacaag
gaccagggtcactcgtcccgcaccaggctggatcgggagcgcctcaaatcctgtatgagg
gagctggagagcatgggacaacaagccaagagcctgagggctcaggtgaagcgacacact
gtacgggacaagctgaggttatgccagaacttcctgcagaagctacgcttcctagctgat
gagccccagcacagcatccccgatgtgttcatttggatgatgagtaataacaaacgtatc
gcctacgcccgcgtgccttccaaagaccttttgttctccattgtggaggaggaattgggc
aaggactgcgccaaggtcaagaccctcttcctgaagctgccaggaaagaggggcttcggc
tcggcaggctggacagtacaggccaagctggaactctacctgtggctgggcctcagcaag
cagagaaaggacttcctgtgtggcctgccttgtggcttcgaggaggtcaaggcagcccaa
ggcctgggtctgcattcctttccgcccatcagccttgtctacaccaagaagcaaaccttc
cagctccgagcccacatgtatcaggcccgaagcctcttcgccgctgacagcactgggctc
tctgatccttttgcccgagtcttcttcatcaaccagagccagtgcacggaggtcctaaac
gagacactgtgtcctacttgggaccaaatgctggtatttgacaacctggagctgtacggt
gaagctcatgagttacgagatgatccccccatcattgtcattgaaatctacgaccaggac
agcatgggcaaagctgacttcatgggccggacctttgccaagcccctggtgaagatggca
gacgaggcatattgcccgcctcgcttcccgccccagcttgagtactaccagatctaccga
ggcaacgccacggccggagacctactggctgcctttgagctgctgcagattggaccatcg
gggaaggctgacctgccacccatcaatggcccagtggacatggacagagggcccatcatg
cctgtgcctgtgggaatccggcccgtgctcagcaagtacagagtggaggtgctgttctgg
ggcctgagggacttaaagagggtgaacctggcccaggtggaccggccacgggtggacatc
gagtgtgcgggaaaaggggtacaatcgtccctgatccacaattataagaagaaccccaac
ttcaacaccctggtcaagtggtttgaagtggacctcccagagaatgagctcctgcaccca
cccttgaacatccgggtggtggactgccgggcctttggacgatacaccctggtgggctcc
catgcagtcagctcactacgacgcttcatctaccgacccccggaccgctcggccgccaac
tggaacaccacagtcaggcttctccggggctaccacatgctgtgcaatgggggcccctct
tcttgccccacaggggaggttgtagtgagcatggaacctgaagtgccagttaagaagctg
gagaccctggtgaagctggatgcgacttctgatgctgtggtcaaggtggatgtggctgaa
gatgagaaggaaaggaagaagaagaaaaagaaaggcccatcagaggaggcagaggaggag
gaacccgatgagagcatgctggattggtggtccaagtactttgcctccattgacacaatg
aaggagcaacttcgacaacatgagacctctgggattgatttggaagagaaggaagaaatg
gatagcactgagggcctgaaggggccagtgaagaacaaggagaagtccagagctgcaaag
gaggaaaaaaagaagaaaaatcagaaccctggccctggccagggatcggaggctcctgag
aagaagaaagccaagatcgacgagcttaaggtgtatcccaaggagctagagtcggagttt
gacaactttgaggactggctgcacacgttcaacctgttacggggcaagactggggatgat
gaggatggctccacagaggaagaacgcatagtaggccgattcaagggttccctctgtgtg
tacaaagtgccactcccggaggatgtgtctcgtgaagctggctacgatcccacctacgga
atgttccagggcatcccaagcaatgaccccattaatgtgctggtccgaatctatgtggtc
cgggccacagacctgcacccggctgacatcaatggcaaagccgacccctatatcgccatc
aagttaggcaagactgacatccgagacaaggagaactacatctccaagcagctcaaccct
gtctttggaaagtcctttgacattgaggcctccttccccatggagtccatgctgacagtg
gctgtgtacgactgggatctggtgggcactgatgacctcatcggagaaaccaagatcgac
ctggaaaaccgcttctacagcaagcaccgtgctacctgcggcatcgcgcagacctattcc
atacatggctataatatctggagagaccccatgaagcccagccagatcctgacccgcctc
tgcaaagagggcaaagtggacggcccccactttggtccccatgggagagtgaaggtcgcc
aaccgtgtcttcacagggccttcagagatagaggatgagaatggtcagaggaagcccaca
gatgagcacgtggcactgtctgctctgagacactgggaggacatcccccgggtgggctgc
cgccttgtaccggagcacgtggagaccaggccgttgctcaaccctgacaagccaggcatt
gagcagggccgcctggagctgtgggtggatatgttccccatggatatgccggcccctgga
acacctctggatatctcccccaggaaacccaagaagtatgagctgcgcgtcatcgtgtgg
aacacagatgaggtggtcctggaagacgacgatttcttcacgggagagaagtccagtgat
atttttgtgagggggtggctgaagggccagcaggaggacaaacaggacacagacgtacat
tatcactccctcacgggtgagggcaacttcaactggcgatacctgttccccttcgactac
ctggcggccgaagagaagatcgttatgtccaagaaggagtccatgttctcctgggatgag
acggagtacaagatacctgcgcggctcaccctgcagatctgggacgctgaccacttctca
gccgatgacttcctgggggccatcgagctggacctgaaccggttcccgaggggcgccaag
acagccaagcagtgcaccatggagatggccaccggggaggtggatgtgcccctggtttcc
atctttaaacagaaacgtgtcaaaggctggtggcccctcctggcccgcaatgagaatgat
gaatttgaactcacgggcaaagtagaggcagagttacacctcctcacggcagaggaggcg
gagaagaacccggtgggcctggctcgcaatgaacctgaccctctagaaaaacccaatcgg
cccgacacaagcttcatctggttcttgaaccctctcaagtctgcccgctacttcctgtgg
catacctaccgctggctgctcctcaaactcctgctgctcctcctcctgctgctgctgctc
gccctgtttctctactctctgcctggctacctggccaagaagatccttggggcctga

DBGET integrated database retrieval system