KEGG   Rattus norvegicus (rat): 84578
Entry
84578             CDS       T01003                                 

Gene name
Hdac3
Definition
(RefSeq) histone deacetylase 3
  KO
K11404  histone deacetylase 3 [EC:3.5.1.98]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04919  Thyroid hormone signaling pathway
rno05034  Alcoholism
rno05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    84578 (Hdac3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    84578 (Hdac3)
  09165 Substance dependence
   05034 Alcoholism
    84578 (Hdac3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    84578 (Hdac3)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     84578 (Hdac3)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     84578 (Hdac3)
SSDB
Motif
Pfam: Hist_deacetyl
Other DBs
NCBI-GeneID: 84578
NCBI-ProteinID: NP_445900
RGD: 619977
Ensembl: ENSRNOG00000019618
UniProt: Q6P6W3
Position
18p11
AA seq 428 aa
MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCR
FHSEDYIDFLQRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNN
KICDIAINWAGGLHHAKKFEASGFCYVNDIVIGILELLKYHPRVLYIDIDIHHGDGVQEA
FYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYKHLFQPVI
SQVVDFYQPXCIVLQCGADSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGGGGYTV
RNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQ
TIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDN
DKESDVEI
NT seq 1287 nt   +upstreamnt  +downstreamnt
atggccaagaccgtggcgtatttctacgaccccgatgtgggcaacttccactacggagct
ggacacccgatgaaaccccatcgcctggcattgactcatagcctagtcctgcattatggt
ctctataagaagatgatcgtcttcaagccttaccaggcctcccagcatgacatgtgccgc
ttccattctgaggactacattgacttcctgcagagagtcagccccaccaatatgcagggt
ttcaccaagagccttaatgccttcaacgtgggtgacgactgccctgtgtttcccgggctc
ttcgagttctgctcccgctatacaggcgcatctctgcaaggggcaacacagctaaacaat
aagatctgtgatattgccatcaactgggctggtggtctacatcatgccaagaagtttgag
gcctctggcttctgctatgtcaatgacatagtaattggtatcctggagctgctcaagtac
caccctcgggtgctgtacattgatattgacatccaccatggtgacggggttcaggaagcc
ttctacctcactgaccgggtcatgactgtgtccttccacaaatatggaaattacttcttt
cctggaacaggtgatatgtatgaagttggagcagagagtggccgctactattgtctcaat
gtgcccttacgggatggcattgatgaccagagttacaagcaccttttccagccggtcatc
agccaggtggtggacttctatcagccganctgcatcgtgctgcagtgtggcgctgactcc
ctgggctgtgatcgattaggctgcttcaatctcagcattcgaggacatggggaatgtgtt
gaatatgtcaagagtttcaatatccctctcctggtgctgggaggtggtggttacaccgtc
cgaaatgttgcccggtgctggacatatgaaacatctctgctggtagaagaggccattagt
gaggaacttccctatagtgaatacttcgagtactttgccccagatttcacgctccatcca
gatgtcagcacccgcatcgagaatcagaactcacgccagtatctagaccagatccgccag
accatctttgaaaacttgaagatgctgaaccatgcacccagtgtccagattcatgatgtt
ccagcagatctcctgacctatgacaggactgacgaggccgatgctgaagagaggggtcct
gaggagaactacagcaggccagaagcacccaatgaattctatgatggagaccatgacaat
gacaaggaaagcgatgtggagatttaa

DBGET integrated database retrieval system