KEGG   Rattus norvegicus (rat): 84583
Entry
84583             CDS       T01003                                 

Gene name
Rgs2
Definition
(RefSeq) regulator of G-protein signaling 2
  KO
K18154  regulator of G-protein signaling 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04022  cGMP-PKG signaling pathway
rno04740  Olfactory transduction
rno04921  Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    84583 (Rgs2)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    84583 (Rgs2)
  09157 Sensory system
   04740 Olfactory transduction
    84583 (Rgs2)
SSDB
Motif
Pfam: RGS COMPASS-Shg1
Other DBs
NCBI-GeneID: 84583
NCBI-ProteinID: NP_445905
RGD: 621665
Ensembl: ENSRNOG00000003687
UniProt: Q9JHX0
Position
13q21
AA seq 211 aa
MQSAMFLAVQHDCVPMDKSAGNGPKVEEKREKMKRTLLKDWKTRLSYFLQNSSTPGKPKT
GKKSKQQTFIKPSPEEALLWAEAFDELLASKYGLAAFRAFLKSEFCEENIEFWLACEDFK
KTKSPQKLSSKARKIYTDFIEKEAPKEINIDFQTKTLIAQNIQEATSGCFTTAQKRVYSL
MENNSYPRFLESEFYQDLCKKPQITTEPHAT
NT seq 636 nt   +upstreamnt  +downstreamnt
atgcaaagtgccatgttcctggctgtccagcacgactgcgtacccatggacaagagcgca
ggcaacggccccaaggtcgaggagaagcgggagaaaatgaagcggacactcttaaaagat
tggaagacccgtttgagctatttcttgcaaaactcctctactcctgggaagcccaaaact
ggcaagaaaagcaaacagcaaacttttatcaagccttctcctgaggaagcgctgctctgg
gcagaagcatttgatgaactgctggccagcaaatatgggcttgctgcattcagagcgttt
ttaaagtccgagttctgtgaagaaaatattgaattctggttggcttgcgaagacttcaag
aaaaccaaatcaccacagaaactgtcctcaaaagcaaggaaaatatacaccgacttcatc
gagaaggaagctcccaaagagataaacatagactttcaaacaaaaactctgattgcccaa
aatatccaagaggctacaagtggctgcttcaccacagcgcagaagagggtgtacagcctg
atggagaacaactcttatcctcgtttcttggaatcagaattttatcaggacttgtgtaaa
aagccacagatcaccacggagccccatgctacatga

DBGET integrated database retrieval system