KEGG   Rattus norvegicus (rat): 84583Help
Entry
84583             CDS       T01003                                 

Gene name
Rgs2
Definition
(RefSeq) regulator of G-protein signaling 2
  KO
K18154  regulator of G-protein signaling 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04022  cGMP-PKG signaling pathway
rno04740  Olfactory transduction
rno04921  Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    84583 (Rgs2)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    84583 (Rgs2)
  09157 Sensory system
   04740 Olfactory transduction
    84583 (Rgs2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RGS COMPASS-Shg1
Motif
Other DBs
NCBI-GeneID: 84583
NCBI-ProteinID: NP_445905
RGD: 621665
Ensembl: ENSRNOG00000003687
UniProt: Q9JHX0
Position
13q21
AA seq 211 aa AA seqDB search
MQSAMFLAVQHDCVPMDKSAGNGPKVEEKREKMKRTLLKDWKTRLSYFLQNSSTPGKPKT
GKKSKQQTFIKPSPEEALLWAEAFDELLASKYGLAAFRAFLKSEFCEENIEFWLACEDFK
KTKSPQKLSSKARKIYTDFIEKEAPKEINIDFQTKTLIAQNIQEATSGCFTTAQKRVYSL
MENNSYPRFLESEFYQDLCKKPQITTEPHAT
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagtgccatgttcctggctgtccagcacgactgcgtacccatggacaagagcgca
ggcaacggccccaaggtcgaggagaagcgggagaaaatgaagcggacactcttaaaagat
tggaagacccgtttgagctatttcttgcaaaactcctctactcctgggaagcccaaaact
ggcaagaaaagcaaacagcaaacttttatcaagccttctcctgaggaagcgctgctctgg
gcagaagcatttgatgaactgctggccagcaaatatgggcttgctgcattcagagcgttt
ttaaagtccgagttctgtgaagaaaatattgaattctggttggcttgcgaagacttcaag
aaaaccaaatcaccacagaaactgtcctcaaaagcaaggaaaatatacaccgacttcatc
gagaaggaagctcccaaagagataaacatagactttcaaacaaaaactctgattgcccaa
aatatccaagaggctacaagtggctgcttcaccacagcgcagaagagggtgtacagcctg
atggagaacaactcttatcctcgtttcttggaatcagaattttatcaggacttgtgtaaa
aagccacagatcaccacggagccccatgctacatga

DBGET integrated database retrieval system