KEGG   Rattus norvegicus (rat): 84596
Entry
84596             CDS       T01003                                 

Gene name
Srm
Definition
(RefSeq) spermidine synthase
  KO
K00797  spermidine synthase [EC:2.5.1.16]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00270  Cysteine and methionine metabolism
rno00330  Arginine and proline metabolism
rno00480  Glutathione metabolism
rno01100  Metabolic pathways
Module
rno_M00034  Methionine salvage pathway
rno_M00133  Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    84596 (Srm)
   00330 Arginine and proline metabolism
    84596 (Srm)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    84596 (Srm)
Enzymes [BR:rno01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.16  spermidine synthase
     84596 (Srm)
SSDB
Motif
Pfam: Spermine_synth Spermine_synt_N Methyltransf_31 Methyltransf_25
Other DBs
NCBI-GeneID: 84596
NCBI-ProteinID: NP_445916
RGD: 620796
Ensembl: ENSRNOG00000011078
UniProt: Q99MI5
Position
5
AA seq 302 aa
MEPGPDGPAAPGPAAIREGWFRETCSLWPGQALSLQVEQLLHHRRSRYQDILVFRSKTYG
NVLVLDGVIQCTERDEFSYQEMIANLPLCSHPNPRKVLIIGGGDGGVLREVVKHPSVESV
VQCEIDEDVIEVSKKFLPGMAVGYSSSKLTLHVGDGFEFMKQNQDAFDVIITDSSDPMGP
AESLFKESYYQLMKTALKEDGILCCQGECQWLHLDLIKEMRHFCKSLFPVVSYAYCTIPT
YPSGQIGFMLCSKNPSTNFREPVQQLTQAQVEQMQLKYYNSDMHRAAFVLPEFTRKALND
IS
NT seq 909 nt   +upstreamnt  +downstreamnt
atggagcctggccccgacggcccagccgcgcccggccccgccgccatccgtgagggttgg
ttccgagagacctgcagcctgtggcctggccaggccctgtcgctgcaagtggagcagctg
ctgcaccaccggcgctcgcggtaccaagacatcctcgtcttccgcagtaaaacctacggc
aacgtgctggttctggatggcgtcatccagtgtaccgagagggacgagttctcctaccag
gagatgatagccaacctgccgctctgcagccaccccaacccgcggaaggtgctgatcatc
gggggtggagatgggggcgtcctacgggaagtggtgaagcacccctctgtggagtctgtg
gtccagtgcgagatcgatgaggatgtcattgaggtctctaagaagttcctgcctggcatg
gccgttggctactccagctcaaagctgactctccacgtgggcgatggctttgagttcatg
aagcagaaccaagatgcctttgatgtcatcatcaccgactcctcagaccccatgggccct
gctgagagcctcttcaaggagtcctattaccagctcatgaagacagccctcaaagaagat
ggcatcctctgttgccagggcgagtgccagtggctgcacctggacctcatcaaggagatg
aggcatttctgcaagtctctcttccctgtggtgagctatgcctactgtaccattcccacc
tatcccagtggccagatcggcttcatgctgtgtagcaaaaacccgagcaccaacttccgg
gagcccgtgcagcagctgacacaggcccaggtagagcagatgcagctgaagtactataac
tcagacatgcaccgcgcggccttcgtgctgccagagttcacccgaaaggccctgaatgac
ataagctga

DBGET integrated database retrieval system