KEGG   Rattus norvegicus (rat): 84599Help
Entry
84599             CDS       T01003                                 

Gene name
Tmed10, Tmp21
Definition
(RefSeq) transmembrane p24 trafficking protein 10
  KO
K20352  p24 family protein delta-1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    84599 (Tmed10)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    84599 (Tmed10)
Membrane trafficking [BR:rno04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   p24 family proteins
    84599 (Tmed10)
Transporters [BR:rno02000]
 Other transporters
  Others
   84599 (Tmed10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EMP24_GP25L
Motif
Other DBs
NCBI-GeneID: 84599
NCBI-ProteinID: NP_445919
RGD: 620970
Ensembl: ENSRNOG00000007901
UniProt: Q63584
Structure
PDB: 

Position
6q31
AA seq 219 aa AA seqDB search
MSGLSGPLSWPGPLLSALLFLFLLGPSSVLGISFHLPVNSRKCLREEIHKDLLVTGAYEI
TDQSGGAGGLRTHLKITDSAGHILYAKEDATKGKFAFTTEDYDMFEVCFESKGTGRIPDQ
LVILDMKHGVEAKNYEEIAKVEKLKPLEVELRRLEDLSESIVNDFAYMKKREEEMRDTNE
STNTRVLYFSIFSMFCLIGLATWQVFYLRRFFKAKKLIE
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgtctggtttgtctggcccactatcctggcctggccctctcctatccgccttgctcttt
ctgttccttctcggccccagctcggtcctcggcatctccttccatctacccgtgaactct
cgcaagtgtctccgcgaggagatccacaaagacttgctggttacgggcgcgtacgagatc
accgaccagtctgggggcgctggcggcctgcgcacccacctcaagatcacagattctgct
ggccatattctgtatgccaaagaggatgcaactaaagggaagtttgcctttaccacagaa
gactatgacatgtttgaagtatgctttgagagcaagggaacagggcggatacctgaccaa
ctagtgattctagacatgaagcatggagtagaggcgaaaaattatgaagagatcgcaaaa
gttgagaaactcaaaccactggaggtggagctacggcgcctcgaggacctttcagagtct
attgttaacgactttgcctacatgaagaagcgggaagaggagatgagggacaccaacgag
tccacaaacacccgcgtcctgtacttcagcatcttttccatgttctgcctcattggacta
gccacctggcaggtcttctacctgcgtcgcttcttcaaggccaagaagttgatagagtaa

DBGET integrated database retrieval system