KEGG   Rattus norvegicus (rat): 84604
Entry
84604             CDS       T01003                                 

Gene name
Hamp
Definition
(RefSeq) hepcidin precursor
  KO
K23106  hepcidin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    84604 (Hamp)
SSDB
Motif
Pfam: Hepcidin TAP35_44
Other DBs
NCBI-GeneID: 84604
NCBI-ProteinID: NP_445921
RGD: 70971
Ensembl: ENSRNOG00000021029
UniProt: Q99MH3
Position
1
AA seq 84 aa
MALSTRIQAACLLLLLLASLSSGAYLRQQTRQTTALQPWHGAESKTDDSALLMLKRRKRD
TNFPICLFCCKCCKNSSCGLCCIT
NT seq 255 nt   +upstreamnt  +downstreamnt
atggcactaagcactcggatccaggctgcctgtctcctgcttctcctcctggccagcctg
agcagcggtgcctatctccggcaacagacgagacagactacggctctgcagccttggcat
ggggcagaaagcaagactgatgacagtgcgctgctgatgctgaagcgaaggaagcgagac
accaacttccccatatgcctcttctgctgtaaatgctgtaagaattcctcctgtggtctc
tgttgcataacatag

DBGET integrated database retrieval system