KEGG   Rattus norvegicus (rat): 84605Help
Entry
84605             CDS       T01003                                 

Gene name
Sval2, SLP-M
Definition
(RefSeq) seminal vesicle antigen-like 2
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: SVA Motile_Sperm
Motif
Other DBs
NCBI-GeneID: 84605
NCBI-ProteinID: NP_579825
RGD: 620869
Ensembl: ENSRNOG00000025541
UniProt: Q99N74
Position
4q24
AA seq 144 aa AA seqDB search
MASLQMFYQPRAAMHLLILCLFLETAYGQDIWSNPLSLELIVSPLKKANEFTVTLQVKNN
VDQCMAVKVSTVSNPNIKYISSHAIYTSCLCDVNNYFWDIQVIANTALQGKAEVVPAKDI
CPNDENIFPVTSYIGTATQKIFVS
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atggcttctcttcaaatgttctatcagcccagagctgctatgcatctcttgattttgtgc
ttatttttggagactgcctatggtcaggacatttggagcaatccactttcactagaactg
atagtttctccactgaaaaaggcaaacgaatttacagtaacactccaggttaaaaataat
gtggaccaatgtatggcggtgaaagtcagtactgtgagcaacccaaacatcaaatacatt
tcttctcatgccatttacacttcctgcctttgcgatgtaaacaactacttctgggacatt
caagtcattgccaatactgccttacaagggaaggcagaagttgttccagctaaggacata
tgtcctaatgatgaaaacatatttccagtaacttcctacatagggactgctacacaaaaa
atctttgtatcatga

DBGET integrated database retrieval system