KEGG   Rattus norvegicus (rat): 84607
Entry
84607             CDS       T01003                                 

Gene name
Socs2, Cish2, Socs-2
Definition
(RefSeq) suppressor of cytokine signaling 2
  KO
K04695  suppressor of cytokine signaling 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04630  JAK-STAT signaling pathway
rno04910  Insulin signaling pathway
rno04917  Prolactin signaling pathway
rno04930  Type II diabetes mellitus
rno04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    84607 (Socs2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    84607 (Socs2)
   04917 Prolactin signaling pathway
    84607 (Socs2)
   04935 Growth hormone synthesis, secretion and action
    84607 (Socs2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    84607 (Socs2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    84607 (Socs2)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     84607 (Socs2)
SSDB
Motif
Pfam: SOCS_box SH2 SH2_2 Condensation
Other DBs
NCBI-GeneID: 84607
NCBI-ProteinID: NP_478115
RGD: 69273
UniProt: O88582
Position
7q13
AA seq 198 aa
MTLRCLEPSGNGADRTRSQWGTAGSPEDQSPEAARLAKALRELSQTGWYWGSMTVNEAKE
KLKEAPEGTFLIRDSSHSDYLLTISVKTSAGPTNLRIEYQDGKFRLDSIICVKSKLKQFD
SVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPTLQHFCRLSINKCTGTIRG
LPLPTRLKDYLEEYKFQV
NT seq 597 nt   +upstreamnt  +downstreamnt
atgaccctgcggtgcctggagccctctgggaatggcgcggacaggacacggagccagtgg
gggacagcggggtcgccggaggatcagtccccggaggcggcgcgtctggcgaaggccctg
cgtgagctcagtcaaacaggatggtactggggaagtatgactgttaatgaagccaaagag
aaattaaaagaggcgccagaaggaactttcttgattagagatagctcccactcagactac
ctattaaccatatctgttaagacatcagccgggccgactaacctgcggattgagtaccaa
gacgggaaattcagattggattctatcatatgtgtcaagtccaagcttaagcagtttgac
agcgtggttcatctgattgactactacgttcagatgtgcaaggacaaacggacaggccct
gaagccccccggaatgggactgttcacctttacctgaccaaacctctgtatacatcagca
ccgacgctgcagcacttctgccgactcagcattaacaagtgtaccggtaccatccgggga
ctacctttaccaacaagactgaaagattacttggaagagtataaattccaggtataa

DBGET integrated database retrieval system