KEGG   Rattus norvegicus (rat): 84608
Entry
84608             CDS       T01003                                 

Gene name
Slco1a6, Oatp5, Slc21a13
Definition
(RefSeq) solute carrier organic anion transporter family, member 1a6
  KO
K03460  solute carrier organic anion transporter family, member 1A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04976  Bile secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    84608 (Slco1a6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    84608 (Slco1a6)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC21/ASLCO: Organic anion transporter
   84608 (Slco1a6)
SSDB
Motif
Pfam: OATP MFS_1 Kazal_2 Kazal_1
Other DBs
NCBI-GeneID: 84608
NCBI-ProteinID: NP_570092
RGD: 69304
Ensembl: ENSRNOG00000030894
UniProt: Q9QYE2
Position
4q44
AA seq 670 aa
MGEPEKRAGTHGIRCFAKIKVFLLALTWAYASKALSATYMNSMLTQIERRFNISTSIVGL
INGSFEVGNLLLIIFVSYFGRKRHRPIMIGIGCAVMGLGCFIISLPHFLMGRYEYETTIS
PTSNLSSNSFLCMENRTQTLKPTQDPAECVKEMKSLMWIYVLVGNIIRGIGETPIMPLGI
SYIEDFAKSENSPFYIGILEVGKITGPIAAIWLGSFCATIYVDMGSVNTDDLTITPTDTR
CVGAWWIGFLVCAGLNILISIPFFFFPKTFPKEGPEDMANETKNDEGDKHREKAKEEKRG
ITKDFFLFMKSLSCNPIYMLCVLTSVLQVNGFVSIFTFKPKYLEHHYGKSSSEAIFLMGL
YTLPSVCVGYLISGFIMKKFKITLKKAAFISYCLGMSECLLSLCNFMLTCDNVPIAGLTT
SYEGIQQSFDMENTVLADCNTRCSCLTKTWDPVCGDNGLAYITPCLAGCEKSVGSGINMV
LQDCSCIQSSGNSSAVLGLCNKGPDCANKLQYFLIITVFCSFFYSLSLIPGYMIFLRCMK
SEEKSLGIGLQAFCMRILGGILAPIYFGVLIDRTCLHWGTQKCGEPGACRTYEINSFRSI
YLGLPAALRGSSYLPAFFILRLMRKFQFPGDINSPVTDHVEMMLTEKESEHTDVHRSPQV
ENDGELKTKL
NT seq 2013 nt   +upstreamnt  +downstreamnt
atgggagagcctgagaaaagggctggaacccacgggatcagatgctttgccaagataaag
gtgtttctgttggcgttaacatgggcatatgcgtccaaagcactatcagcaacttacatg
aattccatgctcacacaaatagagaggcgattcaatatttccacatctatagttgggctt
atcaatgggagctttgaggtaggaaacctcttgttgattatattcgtgagttattttgga
cggaaacggcacagacctatcatgattggcattggatgtgcagtcatgggcctaggatgc
ttcataatctcactacctcatttcctcatgggccgatacgaatatgaaacaacaatttca
cctacaagcaacttgtcctcaaacagcttcttgtgtatggagaaccgaacacagacctta
aagccaacacaagacccagcagagtgtgtgaaagaaatgaaatcattaatgtggatatat
gtactggtaggaaacattatacgtggaattggtgaaactcccatcatgcctttgggtatt
tcctacatagaagactttgccaaatcagaaaactctcccttttacattgggattttagaa
gttggaaagataactggcccaatagctgcaatttggttgggatctttctgtgcaaccatt
tatgtagacatggggtctgtgaatacagatgacctgaccataactcccacagatacacgc
tgtgttggtgcttggtggatcggctttttggtctgtgcaggattgaatatcttgatcagc
atcccctttttcttctttcccaaaacattcccaaaggaaggaccagaggatatggccaat
gaaactaaaaatgacgaaggagataaacacagagaaaaagccaaagaagaaaaaagggga
atcacaaaagatttctttcttttcatgaagagcctctcctgcaatcctatttacatgctt
tgcgtccttacaagtgtgctccaggtaaatggatttgtcagtatttttactttcaagcct
aaatacctggaacatcattatggaaaatccagttcagaggcaatcttcctcatgggtctt
tataccttaccttcagtatgtgttggatatttaattagtggctttattatgaagaagttc
aagattactctcaagaaagcagcattcatatcgtactgcctaggcatgtccgagtgcctt
ctgtccctctgtaactttatgctaacctgtgataacgtcccaattgctggcttaactact
tcttatgaaggaattcagcagtcttttgatatggagaatacggtcctggccgactgcaac
acaaggtgcagctgcttaacaaaaacatgggatccagtgtgtggagacaatggcctagca
tacataacaccttgccttgcaggctgtgagaagtcagttggatcaggaatcaacatggtg
cttcaggattgcagctgcattcagtcatcaggaaactcgtctgcagtcctcgggctgtgt
aacaagggtcctgattgtgccaacaagctacagtacttcttaatcataacggtgttttgt
tccttcttctactcattatcactcatacctgggtacatgatttttctgaggtgtatgaag
tctgaagaaaagtcacttggaattggactacaggcattttgcatgagaatattgggtggc
attctggcacccatttactttggagttttgatagacagaacctgtttacattggggaact
cagaaatgcggtgagcctggggcatgcaggacgtatgaaataaatagcttcaggagcatt
taccttggattgcctgcagctctaagaggatcaagctatctgcctgccttcttcattcta
agacttatgaggaaattccagttccccggggacatcaactctccagtaactgatcatgtg
gagatgatgctcacagagaaggaaagcgagcacacagatgtgcacagaagtcctcaggtc
gagaatgatggagaactgaaaacgaagctgtaa

DBGET integrated database retrieval system