KEGG   Rattus norvegicus (rat): 84683
Entry
84683             CDS       T01003                                 

Gene name
Cox4i2, Cox4b, CoxIV-2
Definition
(RefSeq) cytochrome c oxidase subunit 4i2
  KO
K02263  cytochrome c oxidase subunit 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04260  Cardiac muscle contraction
rno04714  Thermogenesis
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
Module
rno_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    84683 (Cox4i2)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    84683 (Cox4i2)
  09159 Environmental adaptation
   04714 Thermogenesis
    84683 (Cox4i2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    84683 (Cox4i2)
   05012 Parkinson disease
    84683 (Cox4i2)
   05014 Amyotrophic lateral sclerosis
    84683 (Cox4i2)
   05016 Huntington disease
    84683 (Cox4i2)
   05020 Prion disease
    84683 (Cox4i2)
   05022 Pathways of neurodegeneration - multiple diseases
    84683 (Cox4i2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    84683 (Cox4i2)
SSDB
Motif
Pfam: COX4
Other DBs
NCBI-GeneID: 84683
NCBI-ProteinID: NP_445924
RGD: 69422
Ensembl: ENSRNOG00000007827
UniProt: Q91Y94
Position
3q41
AA seq 172 aa
MFSRATRSLVMKTGGLRTQGTHSPGSAASSSQRRMTPYVDCYAQRSYPMPDEPYCTELSE
EQRALKEKEKGSWAQLSQAEKVALYRLQFHETFAEMNHRSNEWKTVMGCVFFFIGFTALV
IWWQRVYVFPKKVVTLTEERKAQQLQRLLDMKSNPIQGLSAHWDYEKKEWKK
NT seq 519 nt   +upstreamnt  +downstreamnt
atgttttccagagctacccggagtctggtaatgaagacaggaggactcagaactcaaggg
acacacagcccaggaagtgctgctagcagcagccagcggaggatgaccccctatgttgac
tgctatgctcagcgctcctatcccatgccggatgagccttactgcacagagctcagcgag
gagcagcgggccctgaaggagaaagagaagggcagctgggctcagctgagccaagcagag
aaggtggccttgtaccggctccagttccacgagaccttcgcagagatgaaccatcgctcc
aacgaatggaagacagtaatgggctgcgtcttcttcttcattggattcacggctctggtg
atttggtggcagcgggtctatgtgttccctaagaaggttgtcaccctgacggaagaacgg
aaagcccagcagctccagcgcctcctggacatgaagagcaaccccatacagggcctgtct
gcccactgggattacgagaagaaagagtggaaaaagtga

DBGET integrated database retrieval system