KEGG   Rattus norvegicus (rat): 85241
Entry
85241             CDS       T01003                                 

Gene name
Pola1
Definition
(RefSeq) DNA polymerase alpha 1, catalytic subunit
  KO
K02320  DNA polymerase alpha subunit A [EC:2.7.7.7]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03030  DNA replication
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    85241 (Pola1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:rno03032]
    85241 (Pola1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     85241 (Pola1)
DNA replication proteins [BR:rno03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase alpha / primase complex
    85241 (Pola1)
SSDB
Motif
Pfam: DNA_pol_B DNA_pol_B_exo1 zf-DNA_Pol DNA_pol_alpha_N DUF1744 DNA_pol_B_2 rRNA_proc-arch
Other DBs
NCBI-GeneID: 85241
NCBI-ProteinID: NP_445931
RGD: 621816
Ensembl: ENSRNOG00000013322
UniProt: O89042
Position
Xq22
AA seq 1468 aa
MAPVHGDDCKLETSAVSDSGSFVASRARREKKSKKGRQEALERLKKAKAGEKYKYEVEDL
TSVYEEVDEEQYSKLVQARQDDDWIVDDDGIGYVEDGREIFDDDLEDDALDTCGEGSDGK
AHRKDRKDVKKPSVTKPNNIKAMFIASAGKKTTDKTVDLSKDDLLGDILQDLNTETPQIA
PPPVLIPKKKRSTGASPNPFSVHTATAVPSGKIASPVSRKEPPLTPVPLKRAEFAGDLAQ
PECPEDEQESGVIEFEDGDFDEPMDTEEVDEEEPVTAKIWDQESEPVEGVKHEADPETGT
TSFLDSFLPDVSCWDIDQKDENSFLLQEVQVDSNHLPLVKGADDEQVFQFYWLDAYEDPY
NQPGVVFLFGKVWVESAKTHVSCCVMVKNIERTLYFLPREMKIDLNTGKETATPITMKDV
YEEFDSKISAKYKIMKFKSKIVEKNYAFEIPDVPEKSEYLEVRYSAEVPQLPQNLKGETF
SHVFGTNTSSLELFLMNRKIKGPCWLEVKNPQLLNQPISWCKFEAMALKPDLVNVIKDVS
PPPLVVMSFSMKTMQNVQNHQHEIIAMAALVHHNFPLDKAPPKPPFQTHFCVVSKPKDCI
FPCAFKEVIKKKNMEVEVAATERTLLGFFLAKVHKLDPDILVGHNICGFELEVLLQRINE
CKVPFWSKIGRLRRSNMPKLGSRSGFGERNATCGRMICDVEISVKELIHCKSYHLSELVQ
QILKTERIVIPTENIRNMYSEPSHLLYLLEHIWKDARFILQIMCELNVLPLALQITNIAG
NIMSRTLMGGRSERNEFLLLHAFYENNYIVPDKQIFRKPQQKPGDEDEEIDGDTNKYKKG
RKKAAYAGGLVLDPKVGFYDKFILLLDFNSLYPSIIQEFNICFTTVQRVASETLKATEDE
EQEQIPELPDPNLDMGILPREIRKLVERRKQVKQLMKQQDLNPDLVLQYDIRQKALKLTA
NSMYGCLGFSYSRFYAKPLAALVTYKGREILMHTKEMVQKMNLEVIYGDTDSIMINTNST
NLEEVFKLGNKVKNEVNKLYKLLEIDIDGVFKSLLLLKKKKYAALVVEPTSDGNYITKQE
LKGLDIVRRDWCDLAKDTGNFVIGQILSDQSRDTIVENIQKRLIEIGENVLNGSVPVSQF
EINKALTKDPQDYPDKKSLPHVHVALWINSQGGRKVKAGDTVSYVICQDGSNLPATQRAY
APEQLQKQDNLAIDTQYYLAQQIHPVVARICEPIDGIDAVLIALWLGLDSTQFRVHQYHK
DEENDALLGGPAQLTDEEKYKDCEKFKCLCPSCGTENIYDNVFEGSGMDMEPSLNRCSNI
DCKASPATFMVQLSNKLIMDIRRCIKKYYDGWLICEEPTCRNRIRRLPLHFSRNGPLCPA
CMKAVLRPEYSDKSLYTQLCFYRYIFDADCALEKLPEHEKDKLKKQFFTPRVLQDYRKVK
NIAEHFLSWSGYSEVNLSKLFANYAGKN
NT seq 4407 nt   +upstreamnt  +downstreamnt
atggcgcctgttcacggagacgactgcaaactggaaacaagcgctgtgtcagattcaggg
agttttgtagcttctcgagcacgtcgagaaaaaaaatcaaagaaaggacgccaagaagct
ttagagcgactgaaaaaggctaaagctggtgagaagtacaagtatgaagttgaggacctc
acaagtgtttatgaagaagttgatgaagagcagtattcaaaactggttcaggcacgtcag
gatgatgactggatcgtggatgacgacggtataggctatgtggaagacggtagagagatt
tttgatgacgaccttgaagatgatgcacttgacacctgtggggaaggaagtgatggcaaa
gcacacagaaaggacaggaaggatgtaaagaaaccttcagtgacaaaaccaaacaatatc
aaggcaatgttcattgctagtgctgggaagaaaaccacagataaaacagttgacttgtcc
aaggatgatctgctaggtgacattctacaggatctgaacactgagacacctcaaatagct
ccaccgccagtattgataccaaagaaaaaaagatctactggagcttcaccgaatcctttc
tctgtgcacaccgccacggcagttccttcaggaaaaattgcttcccctgtctccagaaag
gagcctccattaactcctgttcctcttaaacgtgctgaatttgctggcgatctggctcag
ccagagtgtccagaagatgagcaggagtcaggggttatagagtttgaagatggcgacttt
gatgagcccatggacacagaggaagtagatgaggaggagcctgtgactgccaagatttgg
gaccaagagagtgagccagtggaaggggtgaagcatgaggcagatcctgagacgggaacc
acatctttcttagacagttttctcccagatgtttcttgttgggacattgatcagaaggac
gaaaacagtttcttacttcaagaagttcaagtggactccaatcatctcccgttggtaaaa
ggggcagatgatgaacaagtctttcagttttattggctggatgcttatgaagatccatac
aaccaaccaggtgtggtttttctgtttggcaaagtatgggtcgaatcagccaaaacccat
gtgagctgttgtgttatggtgaaaaatattgagcgaacactctacttccttccccgtgaa
atgaaaattgacctaaacacagggaaagaaacagcaactccaattacaatgaaggatgtt
tatgaagaatttgattcaaaaatttcagcaaaatataaaataatgaagttcaagtccaag
atagtggaaaagaactatgcttttgagatacctgatgttccagaaaaatctgagtacttg
gaagttagatactcggcagaagtgccacagcttccacagaatttaaaaggagaaacattt
tctcatgtatttggaactaacacgtctagcttggaactgttcttgatgaatagaaagatc
aaaggaccctgttggcttgaagtaaaaaatccacaactcttgaatcaaccaatcagttgg
tgtaaatttgaggcaatggctttgaaaccagacttggtgaatgtaattaaggatgtcagt
cctcctccacttgtggtgatgtctttcagcatgaagacaatgcaaaatgtacagaaccat
caacacgagatcattgctatggcagcgctggttcatcacaatttcccattagataaagca
cctccaaaacctccctttcagacgcatttctgtgttgtgtctaaaccaaaggactgtatt
ttcccatgcgctttcaaagaagtcattaagaaaaagaatatggaggttgaggttgctgca
acagaaagaactttgctaggatttttccttgcaaaagttcacaaacttgaccctgatatt
ctcgtgggtcataatatttgtggttttgaactagaagtgctactgcaaagaattaatgag
tgcaaggttcctttctggtccaagataggtcggctgaggagatccaacatgccaaaactt
gggagccggagtggatttggtgaaagaaatgctacctgtggtcgaatgatatgtgatgtg
gaaatttcagtaaaagaattgattcattgtaaaagttaccatttgtctgaacttgttcag
cagattctgaaaactgagaggattgtaattccaacagaaaatatacgaaacatgtatagt
gaaccttctcatctgttgtacctgttggaacacatctggaaagatgccagattcattttg
cagatcatgtgtgagctaaatgttcttccattagcattgcagatcactaacatcgctggg
aacattatgtctaggacactgatgggtggacgatctgagcgaaacgagtttttgttgctt
catgcattttatgaaaacaactatattgtgcctgacaagcagattttcagaaaacctcag
caaaaaccgggagatgaagatgaagaaattgatggggataccaataaatataagaaagga
cgcaagaaagcagcttatgctggaggcttggttttggaccccaaagttggtttttatgac
aagttcattttgctcctggatttcaacagtttatatccttccatcattcaggaatttaac
atttgttttacaacagtgcaaagagttgcttcagagacactgaaagctacagaggatgag
gaacaagaacagattccagagttgccagatccaaacttagatatgggcattttgcccaga
gagatccggaaactggtagagcggagaaaacaagtgaaacagctaatgaaacagcaagat
ttaaatccagaccttgttcttcagtatgatatccgacagaaggctttgaagctcacagcg
aacagtatgtatggttgcctgggattttcgtacagcagattttatgctaaaccgctggct
gccttggtgacatacaaaggaagggagattttgatgcacacgaaagagatggtacagaag
atgaatcttgaagttatttatggagacacagattcaattatgataaataccaatagcacc
aacctggaagaagtctttaagttgggaaacaaggtaaaaaatgaagtgaataaattgtac
aaactgcttgaaatagacattgatggtgttttcaagtctctgctattgctgaagaaaaag
aaatatgctgctctagttgtcgaaccaacatccgatgggaattacatcaccaagcaggaa
ctgaaaggattggatatagttagaagggactggtgtgatcttgccaaggacaccggaaac
tttgtcattggccagattctttctgatcaaagtcgggacaccattgtggaaaacattcag
aagaggttaatagaaattggagaaaatgtgctaaacggcagtgtcccagtgagccagttt
gaaattaacaaggcattgacaaaggatccccaggattaccctgataaaaaaagtctacct
catgtacatgttgcactgtggataaattctcaaggaggcaggaaggtgaaagctggcgat
acagtgtcatatgttatctgtcaggatgggtcaaacctccctgcaactcagagggcctat
gcacccgagcaattgcagaaacaggacaatttagccatcgacacccagtactacttggcc
cagcagatccaccctgttgtggctcgaatctgtgagccaatagatggaattgatgctgta
ctcattgcattatggctaggacttgactccactcaatttagagttcatcagtatcacaaa
gatgaagagaatgatgctctccttggtggtccagcacagctaactgatgaagagaaatac
aaggattgtgaaaaattcaaatgcctttgtccttcatgtggaactgaaaatatttatgat
aatgtctttgaaggctcgggaatggatatggagcccagcttgaatcgttgcagtaatatt
gattgtaaggcttcaccagcgacctttatggtacagttgagcaacaaattgatcatggac
attagacgttgcattaaaaagtactatgatggctggttgatatgtgaggagccaacttgt
cgcaatcgcattcgtcgtcttccccttcatttctcccgaaatgggcctctgtgtccagcc
tgcatgaaagctgtgctcagaccagagtattctgacaagtccctgtacacccagctgtgc
ttttaccggtacatttttgatgcggactgtgcactggaaaaacttcctgaacacgagaaa
gataaattgaagaagcagtttttcactcccagagttcttcaggactacagaaaagtcaag
aacatagcagaacacttcttgtcctggagtggctactctgaagtaaacctcagcaagctc
ttcgccaattatgctgggaagaactga

DBGET integrated database retrieval system