KEGG   Rattus norvegicus (rat): 85242
Entry
85242             CDS       T01003                                 

Gene name
Pola2
Definition
(RefSeq) DNA polymerase alpha 2, accessory subunit
  KO
K02321  DNA polymerase alpha subunit B
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03030  DNA replication
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    85242 (Pola2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:rno03032]
    85242 (Pola2)
DNA replication proteins [BR:rno03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase alpha / primase complex
    85242 (Pola2)
SSDB
Motif
Pfam: DNA_pol_E_B Pol_alpha_B_N
Other DBs
NCBI-GeneID: 85242
NCBI-ProteinID: NP_445932
RGD: 621817
Ensembl: ENSRNOG00000020906
UniProt: Q4V8M9
Position
1q43
AA seq 600 aa
MAVSTQQLAEELQIFGLDCEDSLLEKLAELCTLYRQTEERMVSELIAFCTSAGKSCLTGE
ILSSFEHEVLNKKLSKACHSASKDNRHAGARDIVSIQELIEAEEEEETLLSAYTTPSKGP
HKRVSSTPETPLTKRSISTRSPHQLLSPSSFSPSATPSQKYSSRTNRGEVVTTFGSAQGV
SWSGRGGSGSISLKVMGYPEPLTSSYKTMFQQLPDIREVLTCKIEELGSELKEHYKIEAF
TPLLVPAQEPVILLGQIGCDSNGRLNSKSVILEGDREHSSGAQIPVDMSELKDYSLFPGQ
VVIMEGFNTTGRRLTATKLYEGVPLPFYQPTEEEGDFEQTMVLVACGPYTTSDSITYDPL
LDLISTINHDRLDVCILFGPFLDAKHEQVENCKLTSPFEDIFKQCLRTVIEGTRSSGSHL
VFVPSLRDVHHEPVYPQPPFTFSELPREDKKRVQFVSEPCNLSINGVMFGLTSTDLLFHI
GAEEICSSSGTSDRFSRILKHILTQRSYYPLYPPHEDMAIDYENFYTYAQLPVTPDVFIV
PSELRYFVKDIFGCVCMNPGRLTKGQVGGTFGRLYLRRQPKGTDSEGRQGLSVAAQVVRI
NT seq 1803 nt   +upstreamnt  +downstreamnt
atggccgtgtccacccagcagctggcggaggagctacagatcttcggcctggactgcgag
gactccctgctggagaaattggcagagctgtgtactctgtaccgacagactgaggagagg
atggtgagcgagctgatcgccttctgcaccagcgcagggaaatcgtgcctcactggagag
atcctcagttcctttgagcacgaggttctgaacaaaaagctctccaaagcctgtcacagt
gcctccaaagacaacaggcacgcaggagccagagatattgtctccatacaagagctaatt
gaagcagaggaggaagaggagacccttctgagcgcttacaccacaccctctaagggtcct
cacaagcgagttagcagcaccccagaaacccccctaaccaaaaggagtatctctactcgc
agcccacaccagcttctctccccatcgagtttctccccaagtgctaccccttcccagaaa
tacagctccagaaccaaccggggagaagtggtcaccacctttggctcagcacagggcgtg
tcttggtccgggagaggaggctctggaagcatcagtctgaaggtcatggggtacccagaa
ccactcaccagcagctataaaactatgtttcagcagctcccggatattcgggaagttctg
acctgtaagatagaggagcttggcagcgagctgaaggaacattacaagatcgaggcgttt
acccctctgctagtcccagcacaggaacctgtcatcctgctgggtcagattggctgtgac
agcaacgggaggctaaacagcaagtcagtgatcctcgagggagaccgggagcactcctct
ggcgctcagattccagtggacatgtccgaactcaaagactactctctgtttcctgggcag
gttgtaattatggaaggattcaacaccactggcaggagacttactgccaccaaactctat
gagggtgtgccacttccgttctatcagcccactgaagaggagggagattttgagcagact
atggtgttagttgcctgtgggccttataccacctctgacagcatcacatacgaccccctg
cttgatctgatcagcaccatcaaccatgaccggctagatgtctgcatcctgttcggccct
ttcctggatgctaagcatgaacaagtggagaactgtaagttgacaagcccattcgaagac
attttcaagcagtgcctgagaacagttatcgaaggaacgagaagctccggctcccacctt
gtctttgtcccgtctctgagggatgtgcaccacgagccagtctacccacagccacctttc
accttctccgaactgcctcgagaggacaagaagcgagtgcagtttgtgtcagagccctgc
aacctctccataaatggggtgatgtttggtttgacatccacggacctgctgttccacatt
ggggccgaggagatctgtagctcctctgggacttcagacagattcagccgaatcctcaag
cacatcctgacgcagagaagctactacccactttacccaccccacgaggacatggccata
gactacgagaacttctatacctatgcccagctgccggtcacccctgatgttttcatagtg
ccatcagagctgaggtacttcgtgaaggacatcttcggctgtgtctgtatgaatcctgga
cggctcaccaaaggacaagtgggcggcacctttggccgcctctacctcaggaggcagccc
aagggcacggacagtgaggggaggcaggggctgagtgtggctgcgcaggtggtcagaatc
tga

DBGET integrated database retrieval system