KEGG   Rattus norvegicus (rat): 85243Help
Entry
85243             CDS       T01003                                 

Gene name
Pik3cb
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase, catalytic subunit beta
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00562  Inositol phosphate metabolism
rno01521  EGFR tyrosine kinase inhibitor resistance
rno01522  Endocrine resistance
rno01524  Platinum drug resistance
rno04012  ErbB signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04024  cAMP signaling pathway
rno04062  Chemokine signaling pathway
rno04066  HIF-1 signaling pathway
rno04068  FoxO signaling pathway
rno04070  Phosphatidylinositol signaling system
rno04071  Sphingolipid signaling pathway
rno04072  Phospholipase D signaling pathway
rno04140  Autophagy - animal
rno04150  mTOR signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04152  AMPK signaling pathway
rno04210  Apoptosis
rno04211  Longevity regulating pathway
rno04213  Longevity regulating pathway - multiple species
rno04218  Cellular senescence
rno04360  Axon guidance
rno04370  VEGF signaling pathway
rno04380  Osteoclast differentiation
rno04510  Focal adhesion
rno04550  Signaling pathways regulating pluripotency of stem cells
rno04611  Platelet activation
rno04620  Toll-like receptor signaling pathway
rno04625  C-type lectin receptor signaling pathway
rno04630  Jak-STAT signaling pathway
rno04650  Natural killer cell mediated cytotoxicity
rno04660  T cell receptor signaling pathway
rno04662  B cell receptor signaling pathway
rno04664  Fc epsilon RI signaling pathway
rno04666  Fc gamma R-mediated phagocytosis
rno04668  TNF signaling pathway
rno04670  Leukocyte transendothelial migration
rno04722  Neurotrophin signaling pathway
rno04725  Cholinergic synapse
rno04750  Inflammatory mediator regulation of TRP channels
rno04810  Regulation of actin cytoskeleton
rno04910  Insulin signaling pathway
rno04914  Progesterone-mediated oocyte maturation
rno04915  Estrogen signaling pathway
rno04917  Prolactin signaling pathway
rno04919  Thyroid hormone signaling pathway
rno04923  Regulation of lipolysis in adipocytes
rno04926  Relaxin signaling pathway
rno04930  Type II diabetes mellitus
rno04931  Insulin resistance
rno04932  Non-alcoholic fatty liver disease (NAFLD)
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno04960  Aldosterone-regulated sodium reabsorption
rno04973  Carbohydrate digestion and absorption
rno05100  Bacterial invasion of epithelial cells
rno05142  Chagas disease (American trypanosomiasis)
rno05146  Amoebiasis
rno05160  Hepatitis C
rno05161  Hepatitis B
rno05162  Measles
rno05164  Influenza A
rno05165  Human papillomavirus infection
rno05166  HTLV-I infection
rno05167  Kaposi's sarcoma-associated herpesvirus infection
rno05169  Epstein-Barr virus infection
rno05200  Pathways in cancer
rno05203  Viral carcinogenesis
rno05205  Proteoglycans in cancer
rno05210  Colorectal cancer
rno05211  Renal cell carcinoma
rno05212  Pancreatic cancer
rno05213  Endometrial cancer
rno05214  Glioma
rno05215  Prostate cancer
rno05218  Melanoma
rno05220  Chronic myeloid leukemia
rno05221  Acute myeloid leukemia
rno05222  Small cell lung cancer
rno05223  Non-small cell lung cancer
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
rno05230  Central carbon metabolism in cancer
rno05231  Choline metabolism in cancer
rno05418  Fluid shear stress and atherosclerosis
Module
rno_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    85243 (Pik3cb)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    85243 (Pik3cb)
   04015 Rap1 signaling pathway
    85243 (Pik3cb)
   04012 ErbB signaling pathway
    85243 (Pik3cb)
   04370 VEGF signaling pathway
    85243 (Pik3cb)
   04630 Jak-STAT signaling pathway
    85243 (Pik3cb)
   04668 TNF signaling pathway
    85243 (Pik3cb)
   04066 HIF-1 signaling pathway
    85243 (Pik3cb)
   04068 FoxO signaling pathway
    85243 (Pik3cb)
   04070 Phosphatidylinositol signaling system
    85243 (Pik3cb)
   04072 Phospholipase D signaling pathway
    85243 (Pik3cb)
   04071 Sphingolipid signaling pathway
    85243 (Pik3cb)
   04024 cAMP signaling pathway
    85243 (Pik3cb)
   04151 PI3K-Akt signaling pathway
    85243 (Pik3cb)
   04152 AMPK signaling pathway
    85243 (Pik3cb)
   04150 mTOR signaling pathway
    85243 (Pik3cb)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    85243 (Pik3cb)
  Cell growth and death
   04210 Apoptosis
    85243 (Pik3cb)
   04218 Cellular senescence
    85243 (Pik3cb)
  Cellular community - eukaryotes
   04510 Focal adhesion
    85243 (Pik3cb)
   04550 Signaling pathways regulating pluripotency of stem cells
    85243 (Pik3cb)
  Cell motility
   04810 Regulation of actin cytoskeleton
    85243 (Pik3cb)
 Organismal Systems
  Immune system
   04611 Platelet activation
    85243 (Pik3cb)
   04620 Toll-like receptor signaling pathway
    85243 (Pik3cb)
   04625 C-type lectin receptor signaling pathway
    85243 (Pik3cb)
   04650 Natural killer cell mediated cytotoxicity
    85243 (Pik3cb)
   04660 T cell receptor signaling pathway
    85243 (Pik3cb)
   04662 B cell receptor signaling pathway
    85243 (Pik3cb)
   04664 Fc epsilon RI signaling pathway
    85243 (Pik3cb)
   04666 Fc gamma R-mediated phagocytosis
    85243 (Pik3cb)
   04670 Leukocyte transendothelial migration
    85243 (Pik3cb)
   04062 Chemokine signaling pathway
    85243 (Pik3cb)
  Endocrine system
   04910 Insulin signaling pathway
    85243 (Pik3cb)
   04923 Regulation of lipolysis in adipocyte
    85243 (Pik3cb)
   04915 Estrogen signaling pathway
    85243 (Pik3cb)
   04914 Progesterone-mediated oocyte maturation
    85243 (Pik3cb)
   04917 Prolactin signaling pathway
    85243 (Pik3cb)
   04926 Relaxin signaling pathway
    85243 (Pik3cb)
   04919 Thyroid hormone signaling pathway
    85243 (Pik3cb)
  Digestive system
   04973 Carbohydrate digestion and absorption
    85243 (Pik3cb)
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    85243 (Pik3cb)
  Nervous system
   04725 Cholinergic synapse
    85243 (Pik3cb)
   04722 Neurotrophin signaling pathway
    85243 (Pik3cb)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    85243 (Pik3cb)
  Development
   04360 Axon guidance
    85243 (Pik3cb)
   04380 Osteoclast differentiation
    85243 (Pik3cb)
  Aging
   04211 Longevity regulating pathway - mammal
    85243 (Pik3cb)
   04213 Longevity regulating pathway - multiple species
    85243 (Pik3cb)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    85243 (Pik3cb)
   05230 Central carbon metabolism in cancer
    85243 (Pik3cb)
   05231 Choline metabolism in cancer
    85243 (Pik3cb)
   05205 Proteoglycans in cancer
    85243 (Pik3cb)
   05203 Viral carcinogenesis
    85243 (Pik3cb)
   05210 Colorectal cancer
    85243 (Pik3cb)
   05212 Pancreatic cancer
    85243 (Pik3cb)
   05225 Hepatocellular carcinoma
    85243 (Pik3cb)
   05226 Gastric cancer
    85243 (Pik3cb)
   05214 Glioma
    85243 (Pik3cb)
   05221 Acute myeloid leukemia
    85243 (Pik3cb)
   05220 Chronic myeloid leukemia
    85243 (Pik3cb)
   05218 Melanoma
    85243 (Pik3cb)
   05211 Renal cell carcinoma
    85243 (Pik3cb)
   05215 Prostate cancer
    85243 (Pik3cb)
   05213 Endometrial cancer
    85243 (Pik3cb)
   05224 Breast cancer
    85243 (Pik3cb)
   05222 Small cell lung cancer
    85243 (Pik3cb)
   05223 Non-small cell lung cancer
    85243 (Pik3cb)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    85243 (Pik3cb)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    85243 (Pik3cb)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    85243 (Pik3cb)
   04931 Insulin resistance
    85243 (Pik3cb)
   04933 AGE-RAGE signaling pathway in diabetic complications
    85243 (Pik3cb)
  Infectious diseases
   05100 Bacterial invasion of epithelial cells
    85243 (Pik3cb)
   05166 HTLV-I infection
    85243 (Pik3cb)
   05162 Measles
    85243 (Pik3cb)
   05164 Influenza A
    85243 (Pik3cb)
   05161 Hepatitis B
    85243 (Pik3cb)
   05160 Hepatitis C
    85243 (Pik3cb)
   05163 Human cytomegalovirus infection
    85243 (Pik3cb)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    85243 (Pik3cb)
   05169 Epstein-Barr virus infection
    85243 (Pik3cb)
   05165 Human papillomavirus infection
    85243 (Pik3cb)
   05146 Amoebiasis
    85243 (Pik3cb)
   05142 Chagas disease (American trypanosomiasis)
    85243 (Pik3cb)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    85243 (Pik3cb)
   01524 Platinum drug resistance
    85243 (Pik3cb)
   01522 Endocrine resistance
    85243 (Pik3cb)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     85243 (Pik3cb)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    85243 (Pik3cb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_p85B PI3K_rbd PI3K_C2 Tom37_C DUF4381 DUF4135
Motif
Other DBs
NCBI-GeneID: 85243
NCBI-ProteinID: NP_445933
RGD: 620917
Ensembl: ENSRNOG00000016384
UniProt: Q9Z1L0
Position
8q31
AA seq 1070 aa AA seqDB search
MCFRSIMPPAMADTLDIWAVDSQIASDGSISVDFLLPTGIYIQLEVPREATISYIKQMLW
KQVHNYPMFNLLMDIDSYMFACVNQTAVYEELEDETRRLCDVRPFLPVLKLVTRSCDPAE
KLDSKIGVLIGKGLHEFDALKDPEVNEFRRKMRKFSEDKIQSLVGLSWIDWLKHTYPPEH
EPSVLENLEDKLYGGKLVVAVHFENSQDVFSFQVSPNLNPIKINELAIQKRLTIRGKEEE
ASPCDYVLQVSGRVEYVFGDHPLIQFQYIRNCVMNRTLPHFILVECCKIKKMYEQEMIAI
EAAINRNSSSLPLPLPPKKTRVISHVWGNNNPFQIVLVKGNKLNTEETVKVHVRAGLFHG
TELLCKTVVSSEISGKNDHIWNEQLEFDINICDLPRMARLCFAVYAVLDKVKTKKSTKTI
NPSKYQTIRKAGKVHYPVAWVNTMVFDFKGQLRSGDVILHSWSSFPDELEEMLNPMGTVQ
TNPYAENATALHIKFPENKKQPYYYPPFDKIIEKAAEIASGDSANVSSRGGKKFLAVLKE
ILDRDPLSQLCENEMDLIWTLRQDCRENFPQSLPKLLLSIKWNKLEDVAQLQALLQIWPK
LPPREALELLDFNYPDQYVREYAVGCLRQMSDEELSQYLLQLVQVLKYEPFLDCALSRFL
LERALDNRRIGQFLFWHLRSEVHTPAVSIQFGVILEAYCRGSVGHMKVLSKQVEALNKLK
TLNSLIKLNAMKLNRAKGKEAMHTCLKQSAYREALSDLQSPLNPCVILSELYVEKCRYMD
SKMKPLWLVYSNRAFGEDAVGVIFKNGDDLRQDMLTLQMLRLMDLLWKEAGLDLRMLPYG
CLATGDRSGLIEVVSTSETIADIQLNSSNVAATAAFNKDALLNWLKEYNSGDDLDRAIEE
FTLSCAGYCVASYVLGIGDRHSDNIMVKKTGQLFHIDFGHILGNFKSKFGIKRERVPFIL
TYDFIHVIQQGKTGNTEKFGRFRQCCEDAYLILRRHGNLFITLFALMLTAGLPELTSVKD
IQYLKDSLALGKSEEEALKQFKQKFDEALRESWTTKVNWMAHTVRKDYRS
NT seq 3213 nt NT seq  +upstreamnt  +downstreamnt
atgtgcttccgctctataatgcctcctgctatggcagacacccttgacatctgggccgtg
gattcacagatcgcgtctgatggctccatctctgtcgatttccttctgcccactgggatt
tatatccagttggaagtaccccgggaagctaccatttcttatattaaacagatgttatgg
aagcaagttcacaattacccaatgtttaacctccttatggacattgactcctatatgttt
gcctgtgtgaatcaaactgccgtatatgaggaacttgaagatgaaacacgaagactttgt
gatgtcagacctttccttccagttctcaaactagtgactagaagctgtgacccagcagaa
aaattggactcaaaaattggagttcttataggaaaaggtcttcatgaatttgatgccttg
aaggatcctgaagtgaatgaatttagaagaaaaatgcgcaagttcagcgaggacaagatt
cagtctctggtggggctgtcttggattgactggctcaagcacacgtacccgcccgagcac
gaaccgtccgtcctggagaacctggaagacaaactttatggagggaagctggttgtggct
gtgcattttgaaaatagccaggatgtatttagttttcaagtgtctcccaatttgaatcct
ataaaaataaatgaattggcaatccagaaacgcctcactattcgcgggaaggaagaggaa
gctagcccctgtgactatgtgttacaggtcagtgggagagtggagtatgtgtttggtgac
catccactgattcagttccagtatatccggaattgtgtaatgaacaggaccctgccccat
ttcatccttgtggaatgttgtaagatcaagaaaatgtatgaacaagaaatgattgccata
gaggctgccatcaaccgaaactcctccagccttcctctccctttaccaccaaagaaaaca
cgagttatttctcatgtctggggcaacaacaaccctttccaaattgtcttggtaaaagga
aataagcttaacacagaagaaaccgtgaaagttcatgtcagagccggactttttcatgga
accgagctcctgtgtaaaaccgtcgtaagctcagagatatcaggaaagaatgaccatatt
tggaatgaacaactggaatttgatattaatatttgtgacttaccaagaatggctcgatta
tgttttgctgtttacgcagttttggataaagtaaaaacgaagaaatcaacaaaaactatt
aatccctctaaatatcagaccatcaggaaagcaggaaaagtgcattatcctgttgcatgg
gtaaacaccatggtttttgacttcaaaggacagctgaggtctggagacgtaatattgcac
agctggtcttcgtttcctgatgagctggaagaaatgctgaaccccatggggactgtgcag
acgaacccatatgctgagaatgcaactgccttgcacattaagtttccggagaacaagaag
cagccttattattacccccccttcgataagatcattgagaaggcagctgagattgccagt
ggagacagtgcgaacgtatcaagtcgtggtgggaaaaagtttcttgctgtactgaaagaa
atcttggacagggaccccctgtctcagctgtgtgagaacgaaatggaccttatttggact
ctacggcaagactgccgagaaaatttcccacagtcactgccaaaactactcctgtcaatc
aaatggaataaacttgaagatgttgctcagcttcaggcgctcctgcagatttggcccaaa
ctgccacccagggaagcactggaactcctggatttcaactatccagaccagtatgtccga
gagtacgctgtaggctgcctgcgacagatgagtgatgaagaactctctcagtatctttta
cagttggtgcaagttttgaagtacgagccttttcttgactgtgccctctccagattccta
ttggaaagagcacttgacaaccggaggattggccagtttctgttttggcatcttaggtca
gaggtgcacactcctgctgtgtccattcagtttggtgtcatcctagaggcatactgtcgg
ggaagcgtggggcacatgaaagtgctttccaaacaggttgaagcactcaataaattaaaa
actttaaatagcttaatcaaattgaatgcgatgaagctgaacagagctaaaggaaaggag
gccatgcacacgtgcttaaaacagagtgcctaccgggaggcgctctctgacctgcagtca
cctctgaacccatgtgtcatcctctcagagctctatgtcgaaaagtgcagatacatggac
tccaagatgaagccgctgtggctggtctacagcaacagggcctttggagaggacgcggtg
ggagtgatcttcaaaaatggcgacgatttgcggcaggacatgctgaccctgcagatgctg
cgcctgatggatctgctgtggaaagaagctggcttggacctgcgaatgctcccctatggc
tgtctagcaacaggagatcgctctggcctcattgaggttgtgagcacctctgagacaatc
gctgacattcagctaaacagtagcaacgtggctgccacagcagccttcaacaaagatgct
ctcctgaactggctcaaggagtacaattctggggacgacctggacagagcgattgaggag
ttcaccctgtcctgtgctggctactgtgtagcctcttatgtccttggcattggtgacagg
cacagtgacaacatcatggtgaagaaaaccggccagctcttccacatagactttgggcat
attcttggaaatttcaaatctaaatttggcattaaaagggaacgagtaccttttattctt
acttatgacttcattcatgtcattcaacaaggaaaaacgggaaacacagaaaaatttggc
aggttccgccagtgctgtgaagacgcgtacctgattttacggcggcatgggaatctcttc
attaccctgtttgcgctgatgttgactgcagggcttcccgagctcacatcagtcaaagat
atacagtatcttaaggactctcttgccttaggaaagagtgaagaagaagcactcaaacag
tttaagcagaagtttgatgaggcactcagggaaagctggaccactaaggtgaactggatg
gctcatacagttcggaaagactacaggtcttag

DBGET integrated database retrieval system