KEGG   Rattus norvegicus (rat): 85249Help
Entry
85249             CDS       T01003                                 

Gene name
Pex11a, Pmp26p
Definition
(RefSeq) peroxisomal biogenesis factor 11 alpha
  KO
K13351  peroxin-11A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    85249 (Pex11a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    85249 (Pex11a)
Transporters [BR:rno02000]
 Other transporters
  Pores ion channels [TC:1]
   85249 (Pex11a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEX11
Motif
Other DBs
NCBI-GeneID: 85249
NCBI-ProteinID: NP_445939
RGD: 619842
Ensembl: ENSRNOG00000015003
UniProt: O70597
Position
1q31
AA seq 246 aa AA seqDB search
MDAFIRVANQSQGRDRLFRATQHACMLLRYLLESKAGKEAVVTKLKNLETSVSTGRKWFR
LGNVLHAIQATEQSIQATDLVPRLCLTLANLNRVVYYICDTVLWAKSVGLTSGINREKWQ
MRAARHYYYFLLLSLVRDLYEVLLHMGQVARDRAKREKSSGDPPKYSVANEESEWLQSFL
LLLFQSLKRNPPLFLDTVKNFCDILIPLNQLGIYKSNLGVVGFGGLVSSVAGLITVVYPQ
LKLKAR
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atggacgccttcatccgagtcgccaaccaaagccaaggtcgggaccgacttttcagagcc
actcaacacgcatgcatgttgcttagatatttgttagagtctaaggctggcaaagaggcg
gtggtaacgaagctcaagaatctggagactagtgtgagcactggccgtaaatggttcaga
ctaggcaacgtgctccatgccatccaggccactgagcagagcatccaagccactgacctt
gtgccccgcctatgcctaacattagccaacctgaaccgcgtggtttattacatctgtgac
actgtcctctgggcgaagagtgtgggtctgacatctggaatcaacagagagaagtggcaa
atgcgggcggcccgccactactactatttcctcttgctgagcctggtccgggatctgtat
gaggtcttgctgcatatgggacaagttgcacgtgacagagcaaagagagagaagtcctcc
ggggaccctcctaagtacagcgtcgctaatgaagaaagtgaatggctccagtccttcctc
ctcctcctcttccagtctctaaagcgaaatccgcccttattcctggacaccgtgaagaac
ttctgtgacatcctgatccctttgaaccagctcgggatctacaagtccaaccttggcgtg
gtaggatttggaggtctcgtgtcctctgtggctggcctcatcactgtggtgtatcctcag
ttgaaactgaaggcccgctag

DBGET integrated database retrieval system