KEGG   Rattus norvegicus (rat): 85253Help
Entry
85253             CDS       T01003                                 

Gene name
Plg, Ab1-346
Definition
(RefSeq) plasminogen
  KO
K01315  plasminogen [EC:3.4.21.7]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
rno04610  Complement and coagulation cascades
rno05150  Staphylococcus aureus infection
rno05164  Influenza A
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    85253 (Plg)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    85253 (Plg)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    85253 (Plg)
  09172 Infectious disease: viral
   05164 Influenza A
    85253 (Plg)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    85253 (Plg)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    85253 (Plg)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.7  plasmin
     85253 (Plg)
Peptidases and inhibitors [BR:rno01002]
 Serine peptidases
  Family S1: chymotrypsin family
   85253 (Plg)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   85253 (Plg)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Kringle Trypsin PAN_1 Trypsin_2 DUF1986 DUF3719
Motif
Other DBs
NCBI-GeneID: 85253
NCBI-ProteinID: NP_445943
RGD: 619893
Ensembl: ENSRNOG00000017223
UniProt: Q01177
Position
1q11
AA seq 812 aa AA seqDB search
MDHKEIILLFLLFLKPGQGDSLDGYVSTQGASLHSLTKKQLAAGSIADCLAKCEGETDFI
CRSFQYHSKEQQCVIMAENSKTSSIIRMRDVILFEKRVYLSECKTGIGKGYRGTMSKTKT
GVTCQKWSDTSPHVPKYSPSTHPSEGLEENYCRNPDNDEQGPWCYTTDPDQRYEYCNIPE
CEEECMYCSGEKYEGKISKTMSGLDCQSWDSQSPHAHGYIPAKFPSKNLKMNYCRNPDGE
PRPWCFTTDPNKRWEYCDIPRCTTPPPPPGPTYQCLKGRGENYRGTVSVTASGKTCQRWS
EQTPHRHNRTPENFPCKNLEENYCRNPDGETAPWCYTTDSQLRWEYCEIPSCGSSVSPDQ
SDSSVLPEQTPVVQECYQGNGKSYRGTSSTTNTGKKCQSWVSMTPHSHSKTPANFPDAGL
EMNYCRNPDNDQRGPWCFTTDPSVRWEYCNLKRCSETGGGVAESAIVPQVPSAPGTSETD
CMYGNGKEYRGKTAVTAAGTPCQEWAAQEPHSHRIFTPQTNPRAGLEKNYCRNPDGDVNG
PWCYTMNPRKLYDYCNIPLCASLSSFECGKPQVEPKKCPGRVVGGCVANPHSWPWQISLR
TRFSGQHFCGGTLISPEWVLTAAHCLEKSSRPEFYKVILGAHEERILGSDVQQIAVTKLV
LEPNDADIALLKLSRPATITDNVIPACLPSPNYVVADRTLCYITGWGETKGTPGAGRLKE
AQLPVIENKVCNRAEYLNNRVKSTELCAGHLAGGIDSCQGDSGGPLVCFEKDKYILQGVT
SWGLGCARPNKPGVYVRVSRYVNWIEREMRND
NT seq 2439 nt NT seq  +upstreamnt  +downstreamnt
atggaccataaggaaataatccttctgtttctcttgtttctgaaaccaggacaaggggac
tcactggatggctatgtaagcacacagggggcttcactgcatagcctcaccaagaagcag
ctagcggcaggaagcatagcagactgtttggccaaatgtgaaggggaaacagacttcatc
tgcaggtcattccagtaccacagcaaagagcagcagtgcgtgatcatggccgagaacagc
aagacttcctccatcatccggatgagagatgtcatcttattcgaaaagagagtgtatctg
tcagagtgtaagactggcatcggcaagggctacagaggaaccatgtccaagacaaagact
ggtgttacctgtcaaaagtggagtgacacgtccccccacgtacccaaatactcccccagc
acacaccccagcgagggactagaggagaactactgtaggaacccagacaatgatgaacaa
gggccctggtgctacacaacagacccggaccagagatatgagtactgcaacatccccgaa
tgcgaagaggaatgcatgtactgcagtggagaaaagtacgagggcaaaatctccaagacc
atgtctggactcgactgccagtcctgggattctcagagcccacatgctcacggatacatc
cctgccaaatttccaagcaagaacttgaagatgaattactgtcgcaaccctgacggggag
ccgcggccctggtgcttcaccacagaccccaacaaacgctgggaatactgtgacatcccc
cgctgcacaacacccccacccccaccgggcccaacctaccaatgtctgaaggggagaggt
gaaaattaccgagggaccgtgtctgtcactgcgtctgggaaaacctgtcagcgctggagt
gagcaaacacctcataggcacaacaggacgccagaaaacttcccctgcaaaaatctggaa
gagaactactgccggaacccagatggagaaactgctccctggtgctataccactgacagc
cagctgaggtgggagtactgtgagattccgtcctgcgggtcctcggtatcaccagaccag
tcagattcctcagttcttccggagcaaacacctgtggtccaggagtgctaccagggcaat
ggaaagagctatcggggcacatcgtccactaccaacacagggaagaagtgccagtcctgg
gtatctatgactccacatagtcactcgaagaccccagcgaacttcccagatgctggcttg
gagatgaactactgcaggaacccagataatgaccagaggggcccttggtgcttcaccact
gacccgagcgtcaggtgggaatactgcaacctgaagcggtgctcggagacaggagggggt
gttgcggaatcagccatagtcccccaagttcccagtgcgccaggcacctctgagacagac
tgcatgtatgggaatggcaaagaatatcggggcaaaacggccgtcactgcagctggaacc
ccctgccaggaatgggctgcccaggagccccacagtcacagaatcttcaccccacagaca
aacccacgggcaggtctggaaaagaattactgccgaaacccggatggggatgtcaatggg
ccctggtgctatacaatgaaccccagaaaactttacgactattgtaacattcccctttgt
gcatcattatcgtcctttgaatgtgggaagcctcaggtggagccgaagaaatgccctggg
agggtggtgggtggctgtgtggccaaccctcactcctggccctggcaaatcagccttaga
acaagattttctggacagcacttctgtggcggtactttaatatccccagagtgggtgctg
actgccgctcactgcttggagaaatcttcgagacctgaattctacaaggttatcctggga
gcacacgaagaacgaatccttgggtcagatgttcagcaaatagcagtaaccaaactggtc
ttggaacccaacgacgctgacattgccctgctgaagctaagccgcccagccaccatcaca
gataatgtcatcccagcttgtctgccatctccaaattatgtggttgccgaccggacactg
tgttacatcaccggctggggagaaacgaaagggactccaggtgccggccgtctcaaggag
gcccagctgcccgtgatcgagaacaaggtgtgcaaccgcgctgagtatctaaacaacaga
gtcaaatccaccgagctctgtgccgggcatctggctggtggcatcgacagttgccagggc
gacagtggaggacctctggtttgcttcgagaaggacaagtatattttacaaggagtcact
tcttggggtcttggctgtgctcgccccaataagcctggtgtctatgttcgtgtttcccgg
tacgttaattggattgaaagggagatgaggaatgactaa

DBGET integrated database retrieval system