KEGG   Rattus norvegicus (rat): 85261
Entry
85261             CDS       T01003                                 

Gene name
Mterf1, Mterf
Definition
(RefSeq) mitochondrial transcription termination factor 1
  KO
K15031  transcription termination factor, mitochondrial
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:rno03012]
    85261 (Mterf1)
   03029 Mitochondrial biogenesis [BR:rno03029]
    85261 (Mterf1)
Translation factors [BR:rno03012]
 Eukaryotic type
  Release factors
   85261 (Mterf1)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    85261 (Mterf1)
SSDB
Motif
Pfam: mTERF HTH_39
Other DBs
NCBI-GeneID: 85261
NCBI-ProteinID: NP_445951
RGD: 621318
Ensembl: ENSRNOG00000007899
UniProt: Q9EPI8
Position
4q13
AA seq 374 aa
MASRNIWRVRRNFLFDLRGWVPQYSAEVFLKSIPFRPFSVECNSKDGENGDLLNNLLTMG
VDVDMARRRQPGVFNKAVTNEQELKMFLLSKGASDKVIGSIISRYPRAITRTPESLSKRW
DLWREIMASDLEIVNILERSPESFFRSNNNLNLENNIKFLCSVGLTHKCLCRLLTSAPRT
FSNSLNLNKQMVEFLQETGISLGHNNPTDFVRKIISKNPSILIQSTKRVKTNIEFLQSTF
NLDKEDLLLLICGPGARILDLSNDCTKRNYTNIKKRLLSLGCTEEEVQKFVLSYLNMIFL
SEKKFNDKIDCLLEEKISTSQILENPRVLDSSIHTLKTRIRELAHAGYDVSTSSIALLSW
SQRRYEAKLKRLSG
NT seq 1125 nt   +upstreamnt  +downstreamnt
atggcatcaagaaacatctggcgtgtgagaaggaacttcctctttgatttaagaggttgg
gtgccccaatattcagcagaagttttcctcaagtcgattccattcaggccttttagtgtg
gaatgtaacagtaaagacggggagaatggggacctactcaacaacttactcaccatggga
gttgatgtcgacatggcaaggagacgacagcctggagtttttaacaaggctgtcacgaat
gagcaggagctgaagatgttccttctgtccaaaggagcaagtgacaaagtgattggtagc
atcatatcaagatatccacgagccataacacgcactcccgaaagtctttcaaaacggtgg
gatctgtggagagagattatggcatcagaccttgaaattgtaaatattttggagcgttct
cctgaatccttctttcggtctaataacaacctaaacttagagaataacataaagttcctc
tgctctgttgggttgactcataagtgcctctgccgactgttgaccagtgctcccaggacc
ttctccaacagtctgaatttgaataaacaaatggttgaatttttgcaggagaccggtata
tccttaggtcacaataatcccacagattttgtcaggaagataatttctaaaaatccttcc
atcttaattcagagcaccaaacgtgtgaaaactaacattgaatttttacagtcaactttc
aacttagacaaagaggacctgctgcttctgatatgtggtccaggagctagaatcttagac
ctttccaacgactgtaccaaaagaaactacacaaacatcaaaaagaggctgctctctctc
ggatgcactgaggaggaggtacagaagtttgtcctaagctatctgaatatgatcttcttg
tcagagaaaaagttcaatgataaaatagactgcctcctagaagagaaaatcagtacttca
caaatacttgaaaatccaagggtattagactcgagcatacatactttaaaaactcgcatc
agagagttggcacatgctgggtatgacgtgagcacctcaagcattgctctgctgtcctgg
agtcagagacgatatgaagctaaactgaagagattaagtgggtag

DBGET integrated database retrieval system