KEGG   Rattus norvegicus (rat): 85262
Entry
85262             CDS       T01003                                 

Gene name
Slc25a27, Ucp4
Definition
(RefSeq) solute carrier family 25, member 27
  KO
K15112  solute carrier family 25 (mitochondrial uncoupling protein), member 27
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    85262 (Slc25a27)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   85262 (Slc25a27)
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 85262
NCBI-ProteinID: NP_445952
RGD: 620787
Ensembl: ENSRNOG00000010592
UniProt: Q9EPH7
Position
9q13
AA seq 322 aa
MPFPEEESLQPLTQRWPRTSKFLLSGCAATVAELATFPLDLTKTRLQMQGEAALAKLGDG
AMESAPYRGMMRTALGIVQEEGFLKLWQGVTPAIYRHVVYSGGRMVTYEHLREVVFGKSE
DEHYPLWKSVIGGMMAGVIGQFLANPTDLVKVQMQMEGKRRLEGKPLRFRGVHHAFAKIL
AEGGIRGLWAGWIPNIQRAALVNMGDLTTYDTVKHYLVLNTALEDNIATHGLSSLCSGLV
ASILGTPADVIKSRIMNQPRDKQGRGLLYKSSTDCVIQAVQGEGFLSLYKGFLPSWLRMT
PWSMVFWLTYEKIRQLSGVSPF
NT seq 969 nt   +upstreamnt  +downstreamnt
atgcctttccctgaggaggagtcgctacagccactcacgcagagatggccccggaccagc
aagttcctactgtccggctgcgccgcaaccgtggccgagctagcaacctttcccctcgat
ctcacaaaaacccgactccagatgcaaggagaagctgcccttgctaagttgggagatggt
gcgatggaatccgccccttacaggggcatgatgcgcacggccctggggattgtccaggag
gaaggcttcctaaagttgtggcaaggagtgacgcccgccatttacagacacgtagtgtac
tctggaggtcggatggtcacctacgaacatctccgggaagttgtgtttggcaaaagtgaa
gatgaacattatcccctctggaagtccgtcattggagggatgatggctggcgtcatcgga
cagtttttagccaaccccactgacctcgtgaaggtccagatgcaaatggaagggaaacgt
agactggaagggaaacccttgagattccgtggagtacatcatgcgtttgcaaaaatctta
gctgaaggaggaatccgtgggctttgggcaggctggatacccaatattcagagagcagca
cttgtgaacatgggagatttaaccacttacgacacagtgaagcactacctggtattgaac
acagcacttgaagacaatatcgccactcacggcttatccagtttgtgttctggactggtg
gcttctattctgggaacaccagccgatgtcatcaaaagccgaataatgaaccaacctcga
gacaaacaaggaagagggcttttgtataagtcatcaactgactgcgtgatccaggctgtt
caaggagaaggcttcctgagcctgtataaaggctttctaccctcctggctgagaatgacc
ccttggtcaatggtgttctggcttacttatgaaaaaatcagacagctgagtggagtcagt
ccattctaa

DBGET integrated database retrieval system