KEGG   Rattus norvegicus (rat): 85265Help
Entry
85265             CDS       T01003                                 

Gene name
Ajuba, Jub
Definition
(RefSeq) ajuba LIM protein
  KO
K16682  LIM domain-containing protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04390  Hippo signaling pathway
rno04392  Hippo signaling pathway - multiple species
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    85265 (Ajuba)
   04392 Hippo signaling pathway - multiple species
    85265 (Ajuba)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    85265 (Ajuba)
   03036 Chromosome and associated proteins [BR:rno03036]
    85265 (Ajuba)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     85265 (Ajuba)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     85265 (Ajuba)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LIM
Motif
Other DBs
NCBI-GeneID: 85265
NCBI-ProteinID: NP_445955
RGD: 620407
Ensembl: ENSRNOG00000012791
UniProt: Q5U2Z2
Position
15p13
AA seq 548 aa AA seqDB search
MERLGEKASRLLEKLRLSDSGSAKFGRRKGEASRSGSDGTPGAGKGRLSGLGGPRKSGHR
GANGGPGDEALEPAREQGPLDAERNARGSFEAQRFEGSFPGGPPPTRALPLPLSSPPDFR
LETTAPALSPRSSFASSSASDASKPSSPRGSLLLDGAGASGAGGSRPCSNRTSGISMGYD
QRHGSPLPAGPCLFGLPLTTAPSGYSSGGVPSAYPELHAALDRLCAHRPVGFGCQESRHS
YPPALGSPGALTGAVVGTAGPLERRGTQPGRHSVTGYGDCAAGARYQDELTALLRLTVAT
GGREAGARGEPLGIEPSGLEESPGSFVPEASRSRIREPEAREDYFGTCIKCNKGIYGQSN
ACQALDSLYHTQCFVCCSCGRTLRCKAFYSVNGSVYCEEDYLFSGFQEAAEKCCVCGHLI
LEKILQAMGKSYHPGCFRCIVCNKCLDGVPFTVDFSNQVYCVTDYHKNYAPKCAACGQPI
LPSEGCEDIVRVISMDRDYHFECYHCEDCRMQLSDEEGCCCFPLDGHLLCHGCHMQRLSA
RQPPTNYI
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atggagcggttaggggagaaagccagtcgtctgctagaaaagttgagactttcggactcc
ggcagcgccaagttcggccgcagaaagggcgaagcgagccggtctgggtctgatgggacc
cccggagcaggcaagggacgcctgagtgggctagggggacctaggaaatcaggacaccga
ggagcgaatggggggcctggggatgaagctttggaaccggccagggagcaagggcccctg
gacgccgagcggaacgcacgcggctcctttgaagcgcagcgcttcgaagggtcctttccc
ggggggccgccgcccactcgagccttgcctctgcccctgtcgtcgcctcctgattttcgg
ttggagaccacggctccagcccttagccctcgctccagcttcgccagtagctcggccagc
gatgcgagcaagccatccagcccccggggcagcctgctgctggacggagcgggggccagc
ggagccggtggtagccgcccgtgcagcaatcggaccagcggcatcagcatgggctacgac
cagcgccacgggagcccgctgcctgcggggccgtgcctatttggcctccccctgaccact
gctccttcgggctactcctccggaggggttccatccgcctatccggaactccacgctgcc
ctcgaccgactatgcgctcatcggccggtgggtttcggctgccaggagagccgtcactct
taccccccggccctgggcagccccggagctctaaccggagccgtggtgggaacagcgggt
cctttggagagacgtgggacgcaacccggacgtcactcggttacgggctacggggactgc
gccgcgggagcccgttaccaggacgagctaacagcactgctgcgtttgacggtggctacc
ggtgggcgagaagccggtgcccgcggggaacccttggggattgagccgtcgggtctggag
gagtctcctggttccttcgttccagaggcctcccgatcccggatacgggagccagaggcc
agagaagattactttggcacctgtatcaagtgcaacaaaggtatctatgggcagagcaat
gcctgccaggccctggacagcctctaccacacccagtgctttgtctgctgctcctgtgga
cgaactttgcggtgcaaggctttctacagcgtcaacggctctgtctactgtgaggaagat
tatctgttttcagggtttcaggaggcagctgagaagtgctgtgtctgtggccacttgatt
ctagagaagatcctccaggccatggggaagtcctatcatccaggctgcttccggtgcatc
gtttgtaacaagtgcctggacggcgtccccttcactgtggacttctccaaccaggtgtac
tgtgtgactgactaccacaaaaattacgccccgaaatgtgcagcctgtggacagcccatc
ctcccctcagagggctgtgaggacattgtgagggtgatatccatggaccgtgattatcac
tttgagtgctaccactgtgaggactgccgcatgcagctgagtgacgaggaaggttgctgc
tgtttcccccttgacggacatttgctctgccacggctgtcacatgcagcgcctcagtgcc
cgacagccccctaccaactatatctga

DBGET integrated database retrieval system