KEGG   Rattus norvegicus (rat): 85266Help
Entry
85266             CDS       T01003                                 

Gene name
Prss12, Nt
Definition
(RefSeq) protease, serine 12
  KO
K09624  neurotrypsin [EC:3.4.21.-]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:rno01002]
    85266 (Prss12)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     85266 (Prss12)
Peptidases [BR:rno01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   85266 (Prss12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SRCR Trypsin SRCR_2 Kringle Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 85266
NCBI-ProteinID: NP_445956
RGD: 69238
Ensembl: ENSRNOG00000015353
UniProt: G3V801
Structure
PDB: 

Position
2q42
AA seq 761 aa AA seqDB search
MALARCVLAVILGVLSEVARADPVLHSPLHRPHPSPPRSQHAHYLPSSRRPPRTPRFPLP
PRAPAAQRPQLLSTRHTPPTISRRCGAGEPWGNATNLGVPCLHWDEVPPFLERSPPASWA
ELRGQPHNFCRSPDGAGRPWCFYRNAQGKVDWGYCDCGQGPALPVIRLVGGKSGHEGRVE
LYHAGQWGTICDDQWDDADAEVICRQLGLSGIAKAWHQAHFGEGSGPILLDEVRCTGNEL
SIEQCPKSSWGEHNCGHKEDAGVSCAPLTDGVIRLSGGKSVHEGRLEVYYRGQWGTVCDD
GWTEMNTYVACRLLGFKYGKQSSVNHFEGSSRPIWLDDVSCSGKEASFIQCSRRQWGRHD
CSHREDVGLTCYPDSDGHRLSPGFPIRLMDGENKREGRVEVFVNGQWGTICDDGWTDKHA
AVICRQLGYKGPARARTMAYFGEGKGPIHMDNVKCTGNEKALADCVKQDIGRHNCRHSED
AGVICDYYEKKTSGHGNKETLSSGCGLRLLHRRQTRIIGGNNSLRGAWPWQASLRLKSTH
GDGRLLCGATLLSSCWVLTAAHCFTRYGNNSRSYAVRVGDYHTLVPEGFEQDIGVQQIVI
HRNYRPDSSDYDIALVRLQGSGEQCARLSTHVLPACLPLWRERPQKTASNCHITGWGDTG
RAYSRTLQQAAVPLLPKRFCKERYKGLFTGRMLCAGNLQEDNRVDSCQGDSGGPLMCEKP
DETWVVYGVTSWGYGCGIKDTPGVYTRVPAFVPWIKSVTSL
NT seq 2286 nt NT seq  +upstreamnt  +downstreamnt
atggcgctcgcccgctgcgtgctggctgtgattttaggggtactgtccgaagtggcccgc
gctgatccggtcttgcactcgcccctgcaccgcccgcatccgtctccaccgcgttcccaa
cacgcgcattaccttcccagctcgcggcggccacccaggaccccgcgcttcccgctcccg
ccgcgggcccccgctgcccagcgccctcagctcctcagcacccggcacacgcccccgacg
atttcacgccggtgcggggctggagagccctggggcaatgccaccaacctcggcgtcccg
tgtctacactgggacgaggtgccgcccttcctggagcggtcgcccccggccagttgggct
gagctaagagggcagccgcacaacttctgccggagtccggatggcgcgggcagaccttgg
tgcttctatcgaaatgcccaaggcaaagtggactggggctactgcgattgtggtcaaggc
cccgcgctgcctgtcattcgccttgttggtgggaagagtgggcacgaaggtcgagtggag
ctgtaccacgctggccaatggggaaccatctgtgatgaccaatgggacgacgcagatgca
gaagtcatctgcaggcagctgggtctcagtggcattgccaaagcatggcatcaggcacat
tttggggaaggatctggcccaatattgttggatgaagtacgctgcactgggaatgagctg
tcaattgagcagtgtccaaagagctcctggggtgaacataactgtggccataaagaagat
gccggagtgtcttgtgctcctctgacagatggtgtcatcagactgtcaggagggaaaagt
gtccatgaaggtcgcttggaggtgtactataggggacagtggggaacagtttgtgatgat
ggctggactgaaatgaatacatacgtggcttgtcgactgctgggatttaaatatggcaaa
cagtcctctgtgaaccactttgaaggcagcagcaggcccatatggctggatgacgtcagc
tgctcaggaaaagaagccagcttcattcagtgttccaggagacagtggggaaggcatgac
tgcagccatagggaagatgtgggcctcacctgctaccctgacagtgatggtcataggctt
tccccaggttttcctatcagactaatggacggagagaataagagagaaggacgagtggag
gtttttgtcaatggccaatggggaacgatctgcgatgatggatggaccgacaagcatgca
gctgtgatttgccggcagcttggctataagggtccggccagggcgaggaccatggcttat
tttggggaaggaaaaggccccatccacatggacaatgtgaagtgcacagggaatgagaag
gccctggccgactgcgtcaaacaagacatcggaaggcacaactgccgccacagtgaggac
gcaggagtcatctgtgactattacgagaaaaaaacatcaggtcatgggaataaagagacc
ctctcatctgggtgtggattgagattactacaccgccgacagacacggatcattggtggg
aacaattctttaaggggtgcctggccttggcaggcttccctcaggctgaagtcgacccac
ggagatggcaggctgctctgtggagccacccttctaagtagctgctgggtcctgacagct
gcgcactgtttcacaaggtacggtaacaactcgaggagttatgccgtccgagttggcgat
tatcatactttggttcccgaggggtttgaacaagacataggggtccaacagattgtgatt
cacaggaactatcggccagacagcagcgactatgacatcgccctggtcagattacaaggc
tcaggggagcaatgtgccagactaagcacccacgttttgccagcctgtttacctctatgg
agagaaaggccacagaaaacagcctccaactgtcacataacaggatggggagacacaggt
cgtgcttactcaagaactctacaacaagcagctgtgcctttgttacccaagaggttttgt
aaggaacgttacaagggactgtttactgggagaatgctctgtgctggaaacctccaagaa
gacaaccgtgtggacagctgccagggagacagcggaggaccacttatgtgtgaaaagccc
gatgaaacttgggttgtgtatggggtgacttcctgggggtacggatgcggaatcaaagac
actccaggagtttataccagagtccctgcctttgtaccttggataaaaagtgttacgagt
ctgtaa

DBGET integrated database retrieval system