KEGG   Rattus norvegicus (rat): 85268Help
Entry
85268             CDS       T01003                                 

Gene name
Hrh3
Definition
(RefSeq) histamine receptor H3
  KO
K04151  histamine receptor H3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    85268 (Hrh3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    85268 (Hrh3)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Biogenic amine
   Histamine
    85268 (Hrh3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 DUF621
Motif
Other DBs
NCBI-GeneID: 85268
NCBI-ProteinID: NP_445958
RGD: 620630
Ensembl: ENSRNOG00000061153
UniProt: Q9QYN8 Q5PPG3
Position
3q43
AA seq 445 aa AA seqDB search
MERAPPDGLMNASGTLAGEAAAAGGARGFSAAWTAVLAALMALLIVATVLGNALVMLAFV
ADSSLRTQNNFFLLNLAISDFLVGAFCIPLYVPYVLTGRWTFGRGLCKLWLVVDYLLCAS
SVFNIVLISYDRFLSVTRAVSYRAQQGDTRRAVRKMALVWVLAFLLYGPAILSWEYLSGG
SSIPEGHCYAEFFYNWYFLITASTLEFFTPFLSVTFFNLSIYLNIQRRTRLRLDGGREAG
PEPPPDAQPSPPPAPPSCWGCWPKGHGEAMPLHRYGVGEAGPGVEAGEAALGGGSGGGAA
ASPTSSSGSSSRGTERPRSLKRGSKPSASSASLEKRMKMVSQSITQRFRLSRDKKVAKSL
AIIVSIFGLCWAPYTLLMIIRAACHGRCIPDYWYETSFWLLWANSAVNPVLYPLCHYSFR
RAFTKLLCPQKLKVQPHGSLEQCWK
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atggagcgcgcgccgcccgacgggctgatgaacgcgtcgggcactctggccggagaggcg
gcggctgcaggcggggcgcgcggcttctcggctgcctggaccgctgtcctggctgcgctc
atggcgctgctcatcgtggccacagtactgggcaacgcgctggtcatgctcgccttcgtg
gcggattcgagcctccgcacccagaacaacttctttctgctcaacctcgccatctccgac
ttcctcgtgggtgccttctgcatcccattgtacgtaccctatgtgctgaccggccgttgg
accttcggccggggcctctgcaagctgtggctggtggtagactacctactgtgtgcctcc
tcggtcttcaacatcgtactcatcagctatgaccgattcctgtcagtcactcgagctgtc
tcctacagggcccagcagggggacacgagacgggccgttcggaagatggcactggtgtgg
gtgctggccttcctgctgtatgggcctgccatcctgagttgggagtacctgtctggtggc
agttccatccccgagggccactgctatgctgagttcttctacaactggtactttctcatc
acggcctccaccctcgagttcttcacgcccttcctcagcgttaccttcttcaacctcagc
atctacctgaacatccagaggcgcacccgccttcggcttgatgggggccgtgaggctggc
ccagaacccccaccagatgcccagccctcgccacctccagctccccccagctgctggggc
tgctggccaaaagggcatggcgaggccatgccgttgcacaggtatggggtgggtgaggca
ggccctggtgttgaggctggggaggctgccctcgggggtggcagtggtggaggtgctgct
gcctcgcccacctccagctctggcagctcctcaaggggcactgagaggccacgctcactc
aaaaggggctccaagccatcagcatcttcagcatccctggagaagcgcatgaagatggtg
tcccagagcatcacccagcgcttccggctgtcgcgggacaagaaggtggccaagtcgctg
gccatcatcgtgagcatctttgggctctgctgggcgccgtacacgctcctaatgatcatc
cgagctgcttgccatggccgctgcatccccgattactggtacgagacgtccttctggctt
ctgtgggccaactcggccgtcaaccccgtcctctacccactgtgccactacagcttccgc
agagccttcaccaagctcctctgcccccagaagctcaaggtccagccccacggctccctg
gagcagtgctggaagtga

DBGET integrated database retrieval system