KEGG   Rattus norvegicus (rat): 85272
Entry
85272             CDS       T01003                                 

Gene name
Bmp7, BMP-7
Definition
(RefSeq) bone morphogenetic protein 7
  KO
K16621  bone morphogenetic protein 7
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04350  TGF-beta signaling pathway
rno04360  Axon guidance
rno04390  Hippo signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    85272 (Bmp7)
   04390 Hippo signaling pathway
    85272 (Bmp7)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    85272 (Bmp7)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    85272 (Bmp7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    85272 (Bmp7)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    85272 (Bmp7)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   85272 (Bmp7)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Haparin
  Morphogens
   85272 (Bmp7)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 85272
NCBI-ProteinID: NP_001178785
RGD: 620743
Ensembl: ENSRNOG00000053384
UniProt: G3V6W8
Position
3q42
AA seq 430 aa
MHVRSLRAAAPHSFVALWAPLFLLRSALADFSLDNEVHSSFIHRRLRSQERREMQREILS
ILGLPHRPRPHLQGKHNSAPMFMLDLYNAMAVEESGPDGQGFSYPYKAVFSTQGPPLASL
QDSHFLTDADMVMSFVNLVEHDKEFFHPRYHHREFRFDLSKIPEGEAVTAAEFRIYKDYI
RERFDNETFQITVYQVLQEHSGRESDLFLLDSRTIWASEEGWLVFDITATSNHWVVNPRH
NLGLQLSVETLDGQSINPKLAGLIGRHGPQNKQPFMVAFFKATEVHLRSIRSTGGKQRSQ
NRSKTPKNQEALRMASVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEG
ECAFPLNSYMNATNHAIVQTLVHFINPDTVPKPCCAPTQLNAISVLYFDDSSNVILKKYR
NMVVRACGCH
NT seq 1293 nt   +upstreamnt  +downstreamnt
atgcacgtgcgctcgctgcgcgctgcggcgccacacagcttcgtggcgctctgggcgcct
ctgttcttgctgcgctctgccttggccgacttcagcctggacaacgaggtgcactccagt
ttcatccaccggcgcctccgcagtcaggagcggcgggagatgcagcgggaaatcctgtcc
atcttgggcttgccccatcgtccgcgcccgcacctccagggaaaacataattcggcgccc
atgttcatgttggacctgtacaacgccatggcggtggaggagagtgggccggacggacag
ggcttctcctacccctacaaggccgtcttcagtacccagggtccccctttggccagcctg
caggacagccacttcctcaccgacgccgacatggtcatgagcttcgtcaacctagtggag
cacgacaaggaattcttccaccctcgataccaccatcgagagttccggtttgatctttcc
aagatccccgagggagaggcggtgaccgcagccgagttcaggatctataaggactacatc
cgggagcggtttgacaacgagaccttccagatcacagtctatcaggtgctccaggagcac
tcaggcagggagtccgacctcttcttgctggacagccgtaccatctgggcttctgaggag
ggctggttggtatttgacatcacagccaccagcaaccactgggtggtcaaccctcggcac
aacctgggcttacagctctccgtggagaccctggatgggcagagcatcaaccccaagttg
gcaggcctgattggacggcatggaccccagaacaagcaacccttcatggtggccttcttc
aaggccacggaggttcatctccgtagcatccggtccacggggggcaaacaacgcagccag
aaccgctccaagactccaaagaaccaagaggcactgaggatggccagtgtggcagaaaac
agcagcagtgaccagaggcaggcctgcaagaaacacgagctgtatgttagcttccgagac
cttggctggcaggactggatcatcgcacctgaaggctatgctgcctactactgtgaggga
gagtgtgccttccctctgaactcctacatgaacgccaccaaccatgctatcgtccagaca
ctggttcacttcatcaacccagacaccgtacccaagccctgctgtgcccccacccagctc
aacgcgatatctgtcctctacttcgacgacagctccaacgtcatcctgaagaagtacaga
aacatggtggtccgggcctgtggctgccactag

DBGET integrated database retrieval system