KEGG   Rattus norvegicus (rat): 85327
Entry
85327             CDS       T01003                                 

Gene name
Lin7a, Veli1
Definition
(RefSeq) lin-7 homolog A, crumbs cell polarity complex component
  KO
K19931  protein lin-7
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    85327 (Lin7a)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Others
    85327 (Lin7a)
SSDB
Motif
Pfam: PDZ L27 PDZ_6 PDZ_2 CREPT DUF932 7TMR-HDED
Other DBs
NCBI-GeneID: 85327
NCBI-ProteinID: NP_445966
RGD: 621256
Ensembl: ENSRNOG00000004527
UniProt: Q9Z250
Position
7q21
AA seq 219 aa
MATLTVVQPLTLDRDVARAIELLEKPQESGEVPVHKLQSLKKVLQSEFCTAIREVYQYMH
ETITVNGCPEFRARATAKATVAAFAASEGHSHPRVVELPKTDEGLGFNVMGGKEQNSPIY
ISRIIPGGVAERHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAKDSVKLVVRYTPKVL
EEMEARFEKLRTARRRQQQQLLIQQQQQQQQQPQQNHMS
NT seq 660 nt   +upstreamnt  +downstreamnt
atggcgacattgacagtggtccagccgcttactctggacagagatgttgcaagagcaatc
gaactactagaaaagccacaagaatccggagaagtaccagtgcacaagctgcagtctctc
aaaaaggtgcttcagagtgagttttgtacagcaatccgagaggtgtatcaatacatgcat
gaaacgattactgttaatggctgccctgaattccgtgcgagggccacagcaaaggcaaca
gttgcggcttttgcagccagcgaaggccactcccaccctcgggtagtcgaactgccaaag
actgatgaaggcctgggttttaacgtgatgggaggaaaggaacagaattctccaatttac
atctcccgcatcatccctggaggggtggctgaaagacacggaggcctcaaaagaggagac
cagttgctatcagtgaacggagtgagcgtggaaggggaacatcacgagaaagctgtggaa
cttctcaaggctgctaaggacagtgtgaagctggtcgtcagatacaccccaaaagtcctg
gaggagatggaggctcgttttgaaaagctgaggacagctcggcgtcggcaacagcaacag
ttgcttattcagcagcagcagcagcagcagcagcagccacaacaaaaccacatgtcatag

DBGET integrated database retrieval system