KEGG   Rattus norvegicus (rat): 85385
Entry
85385             CDS       T01003                                 

Gene name
Shc1, P66shc
Definition
(RefSeq) SHC adaptor protein 1
  KO
K06279  SHC-transforming protein 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01521  EGFR tyrosine kinase inhibitor resistance
rno01522  Endocrine resistance
rno04012  ErbB signaling pathway
rno04014  Ras signaling pathway
rno04062  Chemokine signaling pathway
rno04072  Phospholipase D signaling pathway
rno04510  Focal adhesion
rno04650  Natural killer cell mediated cytotoxicity
rno04722  Neurotrophin signaling pathway
rno04910  Insulin signaling pathway
rno04915  Estrogen signaling pathway
rno04917  Prolactin signaling pathway
rno04926  Relaxin signaling pathway
rno04935  Growth hormone synthesis, secretion and action
rno05034  Alcoholism
rno05100  Bacterial invasion of epithelial cells
rno05206  MicroRNAs in cancer
rno05214  Glioma
rno05220  Chronic myeloid leukemia
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    85385 (Shc1)
   04014 Ras signaling pathway
    85385 (Shc1)
   04072 Phospholipase D signaling pathway
    85385 (Shc1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    85385 (Shc1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    85385 (Shc1)
   04062 Chemokine signaling pathway
    85385 (Shc1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    85385 (Shc1)
   04915 Estrogen signaling pathway
    85385 (Shc1)
   04917 Prolactin signaling pathway
    85385 (Shc1)
   04926 Relaxin signaling pathway
    85385 (Shc1)
   04935 Growth hormone synthesis, secretion and action
    85385 (Shc1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    85385 (Shc1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    85385 (Shc1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    85385 (Shc1)
   05226 Gastric cancer
    85385 (Shc1)
   05214 Glioma
    85385 (Shc1)
   05220 Chronic myeloid leukemia
    85385 (Shc1)
   05224 Breast cancer
    85385 (Shc1)
  09165 Substance dependence
   05034 Alcoholism
    85385 (Shc1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    85385 (Shc1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    85385 (Shc1)
   01522 Endocrine resistance
    85385 (Shc1)
SSDB
Motif
Pfam: PID SH2 Delta_lysin
Other DBs
NCBI-GeneID: 85385
NCBI-ProteinID: NP_445969
RGD: 620446
Ensembl: ENSRNOG00000020657
UniProt: Q5M824 F1LN14
Position
2q34
AA seq 469 aa
MNKLSGGGGRRTRVEGGQLGGEEWTRHGSFVNKPTRGWLHPNDKVMGPGVSYLVRYMGCV
EVLQSMRALDFNTRTQVTREAISLVCEAVPGAKGAMRRRKPCSRPLSSILGRSNLKFAGM
PITLTVSTSSLNLMAADCKQIIANHHMQSISFASGGDPDTAEYVAYVAKDPVNQRACHIL
ECPEGLAQDVISTIGQAFELRFKQYLRNPPKLVTPHDRMAGFDGSAWDEEEEEPPDHQYY
NDFPGKEPPLGGVVDMRLREGAARPTLPSTQMPSHLGATLPIGQHVTGDHEVRKQMLPPP
PCPGRELFDDPSYVNIQNLDKARQAGGGAGPPNPSVNGSAPRDLFDMKPFEDALRVPPAP
QSMSMAEQLQGESWFHGKLSRREAEALLQLNGDFLVRESTTTPGQYVLTGLQSGQPKHLL
LVDPEGVVRTKDHRFESVSHLISYHMDNHLPIISAGSELCLQQPVDRKV
NT seq 1410 nt   +upstreamnt  +downstreamnt
atgaacaagctgagtggaggcggcgggcgcaggactcgggtagaagggggccagctgggg
ggcgaggagtggaccagacacgggagctttgtcaataagcccacacgaggctggctgcat
cccaacgacaaagtcatgggacctggggtttcctacttggttcggtacatgggttgcgtg
gaggtcttacagtcaatgcgagcccttgacttcaatacccggactcaggtcaccagggag
gctatcagtttggtgtgtgaagctgtgcctggtgccaaaggggcgatgaggaggagaaag
ccctgcagccgcccactcagctctatcctgggaaggagtaacctgaagtttgctggaatg
ccgatcactctcactgtgtctaccagcagccttaacctcatggcagcagactgcaaacag
atcattgccaaccatcacatgcaatctatctcattcgcgtctggtggggatccggacaca
gctgagtacgttgcctatgttgccaaagaccctgtgaatcagagagcctgccatatcctg
gagtgtcctgaaggacttgctcaggacgtcatcagcaccatcgggcaggcctttgagttg
cgcttcaaacagtatctcaggaatccacccaagctggtcaccccccatgacaggatggct
ggctttgatggctcagcttgggatgaggaggaagaagagccccctgaccatcagtactac
aatgacttcccagggaaggaaccccctcttggtggagtggtagatatgaggcttcgggaa
ggggctgctcgacccactctgcccagtacccagatgcccagccacttgggagctacactg
ccaatagggcagcatgttacaggagaccatgaagtccgtaaacagatgctgcctccacca
ccgtgcccaggcagagaactcttcgatgatccttcctatgtcaacatccagaatctagac
aaggcccggcaagctggtggtggggctggacccccaaatccttctgttaatggcagtgca
ccccgagacctctttgacatgaagcccttcgaagatgcactccgggtgccgccagctccc
cagtccatgtccatggctgagcagctccaaggggagtcctggtttcatgggaaactcagc
cggcgggaggctgaggcgctgctgcagctcaacggtgacttcttggtgcgagagagtaca
accacacctggccagtacgtgctcactggtctgcagagtgggcagcccaagcacttgctt
ctggtggaccctgaaggtgtggttcggacaaaggatcaccgctttgagagtgtcagtcac
ctgatcagctaccacatggacaatcacttacccatcatctctgcaggcagtgagctgtgt
ctacagcaacctgtggatcgaaaagtgtga

DBGET integrated database retrieval system