KEGG   Rattus norvegicus (rat): 85420Help
Entry
85420             CDS       T01003                                 

Gene name
Prkcq, Pkcq
Definition
(RefSeq) protein kinase C, theta
  KO
K18052  novel protein kinase C theta type [EC:2.7.11.13]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04064  NF-kappa B signaling pathway
rno04140  Autophagy - animal
rno04270  Vascular smooth muscle contraction
rno04658  Th1 and Th2 cell differentiation
rno04659  Th17 cell differentiation
rno04660  T cell receptor signaling pathway
rno04750  Inflammatory mediator regulation of TRP channels
rno04920  Adipocytokine signaling pathway
rno04931  Insulin resistance
rno05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    85420 (Prkcq)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    85420 (Prkcq)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    85420 (Prkcq)
   04658 Th1 and Th2 cell differentiation
    85420 (Prkcq)
   04659 Th17 cell differentiation
    85420 (Prkcq)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    85420 (Prkcq)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    85420 (Prkcq)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    85420 (Prkcq)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    85420 (Prkcq)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    85420 (Prkcq)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    85420 (Prkcq)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     85420 (Prkcq)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   85420 (Prkcq)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr C1_1 Pkinase_C Kinase-like zf-RING_9 Haspin_kinase C1_2 Zf_RING APH DUF2318
Motif
Other DBs
NCBI-GeneID: 85420
NCBI-ProteinID: NP_001263650
RGD: 620968
Ensembl: ENSRNOG00000019057
UniProt: F1LM10
Position
17q12.3
AA seq 707 aa AA seqDB search
MSPFLRIGLSNFDCGTCQACQGEAVNPYCAVLVKEYVESENGQMYIQKKPTMYPPWDSTF
DAHINKGRVMQIIVKGKNVDLISETTVELYSLAERCRKNNGRTEIWLELKPQGRMLMNAR
YFLEMSDTKDMSEFENEGFFALHHRRGAIKQAKVHHVKCHEFTATFFPQPTFCSVCHEFV
WGLNKQGYQCRQCNAAIHKKCIDKVIAKCTGSAINSRETMFHKERFKIDMPHRFKVYNYK
SPTFCEHCGTLLWGLARQGLKCDACGMNVHHRCQTKVANLCGINQKLMAEALAMIESTQQ
ARTLRDSEHIFREGPIEISFPRSIKSETRPPCVPTPGKKEPQGICWESPLDGADKTAQPP
EPEVNLQRASLQLKLKIDDFILHKMLGKGSFGKVFLAEFKRTKQFFAIKALKKDVVLMDD
DVECTMVEKRVLSLAWEHPFLTHMFCTFQTKENLFFVMEYLNGGDLMYHIQSCHKFDLSR
ATFYAAEIILGLQFLHSKGIVYRDLKLDNILLDRDGHIKIADFGMCKENMLGDAKTNTFC
GTPDYIAPEILLGQKYNHSVDWWSFGVLLYEMLIGQSPFHGQDEEELFHSIRMDNPFYPR
WLEREAKDLLVKLFVREPEKRLGVRGDIRQHPLFREINWEELERKEIDPPFRPKVKSPYD
CSNFDKEFLSEKPRLSFADRALINSMDQNMFSNFSFINPGMETLICS
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atgtcaccgtttcttcgaattggtttatccaactttgactgtgggacctgtcaagcttgt
cagggagaggcggtgaacccctactgtgccgtgcttgtcaaagagtatgtggaatcagaa
aacgggcagatgtacatccagaaaaagccgaccatgtacccgccttgggacagcaccttt
gatgcccacattaacaagggaagggtgatgcagatcatcgtgaaaggcaaaaatgtagac
ctcatatcagaaaccaccgtggagctctactccctggcagagagatgccgcaagaacaat
gggcggacagaaatatggttagagctgaaacctcaaggccgaatgctaatgaatgcaaga
tactttctggaaatgagtgacacaaaggacatgagtgaatttgagaacgaaggattcttt
gcactgcatcaccgccgaggcgccatcaaacaagccaaagtccaccacgtcaagtgtcac
gagttcacagccacctttttccctcaacccacgttctgctctgtctgccatgaatttgtc
tgggggctgaacaagcagggctaccagtgccgacaatgtaatgcagcgattcacaagaag
tgcatcgataaagtgatagccaagtgcacaggatcggcgatcaatagtcgagagaccatg
ttccacaaggagagattcaagatcgacatgccacacagattcaaagtctacaactacaag
agtccaaccttctgtgagcactgtggtaccctgctatgggggctggcgaggcaaggtctc
aagtgtgatgcatgtggcatgaacgtccaccaccgatgccagacaaaggttgccaacctc
tgtggtataaaccagaagctaatggctgaagcgctagcaatgattgaaagcactcaacag
gctcgcaccttaagagattcagaacacatcttccgagaaggaccaattgaaatcagtttc
ccgcgctccatcaaaagtgaaaccaggccaccatgcgtaccaacacctgggaaaaaagaa
ccccagggaatttgctgggagtcccctttggatggggcagataaaacggcccagcctcct
gaacctgaagtgaacttgcaaagggcttctctgcaactgaaactgaagatcgatgacttc
atcctgcacaagatgctggggaaaggaagttttggcaaggtcttcctggcagagttcaag
agaaccaaacagtttttcgcaataaaagccttaaagaaagatgtggtgttgatggacgat
gacgtcgagtgcacgatggtggagaagagagttctgtccttggcctgggagcatccgttt
cttacacacatgttctgcacattccagaccaaggaaaatctctttttcgtgatggagtat
ctcaatggaggagacttaatgtaccacatccaaagttgccacaaatttgatctttccaga
gccacgttttatgctgctgagatcatccttggtctacagttccttcattccaaaggaatt
gtctacagggacctgaagctagataatatcctgttagacagagatggccatatcaaaata
gcagactttgggatgtgcaaagagaatatgctgggagatgcgaagacaaatactttctgt
gggacgcctgactacatcgctccggagatcttgctgggtcagaaatacaaccattccgtt
gactggtggtcctttggggttcttctttacgagatgctgattggccagtcgcctttccac
gggcaggacgaagaggagcttttccactccatccgcatggacaatcccttttacccaagg
tggctagaaagggaggccaaggatcttctagtgaagctttttgtgagagagcctgaaaag
aggctgggagtgagaggagacatccgccagcatcctttgtttcgagagatcaactgggaa
gagcttgagagaaaagagattgacccacccttcagaccaaaagtgaaatcaccatatgac
tgtagcaatttcgacaaggaattcctaagtgagaaaccccggctatcgttcgctgacaga
gcactcatcaacagcatggaccagaacatgttcagcaacttctccttcattaacccgggg
atggagactctcatttgctcctga

DBGET integrated database retrieval system